<?xml version='1.0'?>
<!DOCTYPE art SYSTEM 'http://www.biomedcentral.com/xml/article.dtd'>
<art>
   <ui>1743-422X-3-10</ui>
   <ji>1743-422X</ji>
   <fm>
      <dochead>Research</dochead>
      <bibl>
         <title>
            <p>Pox proteomics: mass spectrometry analysis and identification of Vaccinia virion proteins</p>
         </title>
         <aug>
            <au id="A1">
               <snm>Yoder</snm>
               <mi>D</mi>
               <fnm>Jennifer</fnm>
               <insr iid="I1"/>
               <email>yoderj@science.oregonstate.edu</email>
            </au>
            <au id="A2">
               <snm>Chen</snm>
               <mi>S</mi>
               <fnm>Tsefang</fnm>
               <insr iid="I1"/>
               <email>susan.yeh@cox.net</email>
            </au>
            <au id="A3">
               <snm>Gagnier</snm>
               <mi>R</mi>
               <fnm>Cliff</fnm>
               <insr iid="I1"/>
               <email>gagnierc@onid.orst.edu</email>
            </au>
            <au id="A4">
               <snm>Vemulapalli</snm>
               <fnm>Srilakshmi</fnm>
               <insr iid="I2"/>
               <email>vemulasr@onid.orst.edu</email>
            </au>
            <au id="A5">
               <snm>Maier</snm>
               <mi>S</mi>
               <fnm>Claudia</fnm>
               <insr iid="I3"/>
               <email>claudia.maier@oregonstate.edu</email>
            </au>
            <au id="A6" ca="yes">
               <snm>Hruby</snm>
               <mi>E</mi>
               <fnm>Dennis</fnm>
               <insr iid="I1"/>
               <email>hrubyd@oregonstate.edu</email>
            </au>
         </aug>
         <insg>
            <ins id="I1">
               <p>Oregon State University, Department of Microbiology, 220 Nash Hall, Corvallis, OR 97331-3804, USA</p>
            </ins>
            <ins id="I2">
               <p>Oregon State University, Applied Biotechnology Program, 2082 Cordley Hall, Corvallis, OR 97331-8530, USA</p>
            </ins>
            <ins id="I3">
               <p>Oregon State University, Department of Chemistry, 153 Gilbert Hall, Corvallis, OR 97331-4003, USA</p>
            </ins>
         </insg>
         <source>Virology Journal</source>
         <issn>1743-422X</issn>
         <pubdate>2006</pubdate>
         <volume>3</volume>
         <issue>1</issue>
         <fpage>10</fpage>
         <url>http://www.virologyj.com/content/3/1/10</url>
         <xrefbib>
            <pubidlist>
               <pubid idtype="pmpid">16509968</pubid>
               <pubid idtype="doi">10.1186/1743-422X-3-10</pubid>
            </pubidlist>
         </xrefbib>
      </bibl>
      <history>
         <rec>
            <date>
               <day>16</day>
               <month>2</month>
               <year>2006</year>
            </date>
         </rec>
         <acc>
            <date>
               <day>01</day>
               <month>3</month>
               <year>2006</year>
            </date>
         </acc>
         <pub>
            <date>
               <day>01</day>
               <month>3</month>
               <year>2006</year>
            </date>
         </pub>
      </history>
      <cpyrt>
         <year>2006</year>
         <collab>Yoder et al; licensee BioMed Central Ltd.</collab>
         <note>This is an Open Access article distributed under the terms of the Creative Commons Attribution License (<url>http://creativecommons.org/licenses/by/2.0</url>), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.</note>
      </cpyrt>
      <abs>
         <sec>
            <st>
               <p>Abstract</p>
            </st>
            <sec>
               <st>
                  <p>Background</p>
               </st>
               <p>Although many vaccinia virus proteins have been identified and studied in detail, only a few studies have attempted a comprehensive survey of the protein composition of the vaccinia virion. These projects have identified the major proteins of the vaccinia virion, but little has been accomplished to identify the unknown or less abundant proteins. Obtaining a detailed knowledge of the viral proteome of vaccinia virus will be important for advancing our understanding of orthopoxvirus biology, and should facilitate the development of effective antiviral drugs and formulation of vaccines.</p>
            </sec>
            <sec>
               <st>
                  <p>Results</p>
               </st>
               <p>In order to accomplish this task, purified vaccinia virions were fractionated into a soluble protein enriched fraction (membrane proteins and lateral bodies) and an insoluble protein enriched fraction (virion cores). Each of these fractions was subjected to further fractionation by either sodium dodecyl sulfate-polyacrylamide gel electophoresis, or by reverse phase high performance liquid chromatography. The soluble and insoluble fractions were also analyzed directly with no further separation. The samples were prepared for mass spectrometry analysis by digestion with trypsin. Tryptic digests were analyzed by using either a matrix assisted laser desorption ionization time of flight tandem mass spectrometer, a quadrupole ion trap mass spectrometer, or a quadrupole-time of flight mass spectrometer (the latter two instruments were equipped with electrospray ionization sources). Proteins were identified by searching uninterpreted tandem mass spectra against a vaccinia virus protein database created by our lab and a non-redundant protein database.</p>
            </sec>
            <sec>
               <st>
                  <p>Conclusion</p>
               </st>
               <p>Sixty three vaccinia proteins were identified in the virion particle. The total number of peptides found for each protein ranged from 1 to 62, and the sequence coverage of the proteins ranged from 8.2% to 94.9%. Interestingly, two vaccinia open reading frames were confirmed as being expressed as novel proteins: E6R and L3L.</p>
            </sec>
         </sec>
      </abs>
   </fm>
   <meta>
      <classifications>
         <classification type="bmc" subtype="user_supplied_xml" id="endnote"/>
      </classifications>
   </meta>
   <bdy>
      <sec>
         <st>
            <p>Background</p>
         </st>
         <p>Variola virus (smallpox agent) and/or genetically-engineered orthopoxviruses are considered one of the most significant Category A pathogenic threats for malevolent use as potential agents of bioterrorism <abbrgrp><abbr bid="B1">1</abbr></abbrgrp>. Due to the bioterrorism threat, there is a renewed public interest in the development of effective anti-poxvirus drug(s) and/or vaccines for use in treating or preventing human diseases caused by pathogenic poxviruses. Because the nucleotide sequence of the variola virus is approximately 90% identical with that of the vaccinia virus, VV <abbrgrp><abbr bid="B2">2</abbr></abbrgrp>, we hypothesize that VV can act as a model for variola. At present, there are no effective anti-orthopoxvirus drugs available, and the Dryvax vaccine used during the eradication campaign is not considered safe for general use, considering immuno-compromised people, and the complications associated with this live-attenuated vaccine.</p>
         <p>Poxviruses, such as VV, are amongst the largest and most complex of the eukaryotic DNA viruses and are distinguished by replicating exclusively within the cytoplasmic compartment of infected cells <abbrgrp><abbr bid="B3">3</abbr></abbrgrp>. VV regulates the expression of more than 250 viral gene products in a temporal fashion during the viral replicative cycle which results in at least four infectious forms all of which share the same intracellular mature virus (IMV) at their center which contains one membrane and a concave brick core. VV proteins are denoted by their corresponding open reading frame (ORF). The conventional designation of VV ORF consists of a Hind III DNA fragment (A-O), followed by the number of the ORF in that fragment (numbered left to right), and finally by the direction of the ORF (L or R).</p>
         <p>Although the complete genome sequence of VV (strain Copenhagen) has been available for years <abbrgrp><abbr bid="B4">4</abbr></abbrgrp>, there has been little comprehensive proteomic analysis of the VV virion described so far. Jensen, <it>et al</it>. identified 13 major membrane and core proteins of the VV virion using 2-D gel electrophoresis followed by in-gel trypsin digests and peptide mass fingerprints for database searching <abbrgrp><abbr bid="B5">5</abbr></abbrgrp>. Using a similar gel-based strategy, three major early proteins associated with the virosomes in VV-infected cells were identified by Murcia-Nicolas, <it>et al</it>. <abbrgrp><abbr bid="B6">6</abbr></abbrgrp>.</p>
         <p>In this report we have utilized tandem mass spectrometry (MS) to analyze the protein composition of the vaccinia virion. A comprehensive proteome analysis of the protein composition of the VV virion represents an analytical challenge as there is no general analytical strategy available that is capable of identifying membrane and core proteins, low and high abundant proteins equally well. Therefore, we have used several analytical strategies to obtain a large number of high confidence protein identifications. Two different separation strategies [high performance liquid chromatography (HPLC) and sodium dodecyl sulfate-polyacrylamide gel electophoresis (SDS-PAGE)] were combined with tandem mass spectrometry. In addition, a "shotgun" approach with no further separation was evaluated. For the tandem mass spectrometry, three different MS instruments were utilized: 1.) a matrix assisted laser desorption ionization tandem mass spectrometer with time-of-flight/time-of-flight optics (MALDI-TOF/TOF), 2.) a quadrupole-time of flight mass spectrometer (LC-ESI-Q-TOF), and 3.) a quadrupole ion trap mass spectrometer (LC-ESI-QIT); the latter two instruments were equipped with online HPLC and electrospray ionization interfaces <abbrgrp><abbr bid="B7">7</abbr></abbrgrp>. In the process of analyzing the vaccinia virion, we have identified sixty three VV proteins, two of which have not been reported previously.</p>
      </sec>
      <sec>
         <st>
            <p>Results</p>
         </st>
         <sec>
            <st>
               <p>Viral fractionation</p>
            </st>
            <p>In order to simplify our analytical strategy, we partitioned the vaccinia virion into two enriched fractions: a supernatant or membrane fraction containing the soluble proteins and a fraction enriched with the cores and insoluble proteins. The fractionation was assisted by incubating purified virions in the presence of a reducing agent and non-ionic detergent. Beta-octylglucopyranoside (OG) was chosen as the detergent for dissolving the membrane because in low amounts it does not adversely affect MS analysis, whereas, conventional detergents such as SDS and Triton X100 can greatly interfere with HPLC and mass spectrometric analysis <abbrgrp><abbr bid="B8">8</abbr></abbrgrp>. We tested the efficiency of OG in separating the virion components and found that the supernatant and pellet banding patterns on an SDS-PAGE gel differ (Figure <figr fid="F1">1A</figr> and <figr fid="F1">1B</figr>). Subsequent analysis of this separation with immunoblot analysis using antibodies to L1R (membrane protein) and 4b (A10L, core protein) showed that each fraction was enriched with these proteins (data not shown). Due to the comprehensive nature of this study, no attempts were made to completely separate the soluble membrane proteins from the core proteins.</p>
            <fig id="F1">
               <title>
                  <p>Figure 1</p>
               </title>
               <caption>
                  <p>Mass analysis of a distinct peptide from the L4R protein using Method 1 (SDS-PAGE + LC-ESI-Q-TOF MS)</p>
               </caption>
               <text>
                  <p><b>Mass analysis of a distinct peptide from the L4R protein using Method 1 (SDS-PAGE + LC-ESI-Q-TOF MS) </b>Panel A shows the Coomassie blue stained SDS-PAGE gel of the core-enriched fraction and panel B is the membrane-enriched fraction. Gel slices that were analyzed by MS are denoted with letters. The full scan mass spectrum (inset of C) displays a doubly charged parent ion at m/z 867.9. The corresponding tandem mass spectrum (C) identifies a peptide of the L4R protein. Asterisks (*) denote the loss of ammonia (NH<sub>3</sub>) or water (H<sub>2</sub>O).</p>
               </text>
               <graphic file="1743-422X-3-10-1"/>
            </fig>
         </sec>
         <sec>
            <st>
               <p>Identification of VV proteins</p>
            </st>
            <p>Table <tblr tid="T1">1</tblr> summarizes the results of our proteomic study. Tandem mass spectrometry yields peptide sequences, allowing the search of non-redundant protein databases to obtain high confidence protein identifications. In total, over 2716 tandem mass spectra were analyzed to yield sequence information for 595 non-redundant peptides. Peptides scores of 40 or greater were considered positive matches. In rare cases, tandem mass spectra that yielded scores 20 and 40 were analyzed manually. In order for a protein to be a "positive" we used the following criteria: 1.) identify greater than 5% of the protein sequence; 2.) more than one peptide needed to be identified in a single method, or a single peptide needed to be identified at least with two different methods. Using these stringent conditions, sixty three different proteins were identified in the vaccinia virion. The total number of peptides found for each protein ranged from 1 to 62 (Table <tblr tid="T1">1</tblr>, column 5), and the total sequence coverage of the proteins ranged from 8.2% to 94.9% (Table <tblr tid="T1">1</tblr>, column 6). Of the sixty three proteins identified, 2 are predicted gene products that have not been shown to be expressed before: E6R and L3L (Table <tblr tid="T1">1</tblr>, italicized).</p>
            <tbl id="T1">
               <title>
                  <p>Table 1</p>
               </title>
               <caption>
                  <p>Vaccinia virion proteins identified in this study. Membrane- and core-enriched fractions were both analyzed by five different methods: Method 1 (SDS-PAGE + LC-ESI-Q-TOF MS), Method 2 (SDS-PAGE + LC-ESI-QIT MS), Method 3 (HPLC + LC-ESI-QIT MS), Method 4 (LC-ESI-Q-TOF MS), and Method 5 (MALDI-TOF/TOF MS). Identified proteins are listed according to their corresponding ORF. The total number of non-redundant peptides and the percent of the protein identified are recorded.</p>
               </caption>
               <tblbdy cols="6">
                  <r>
                     <c ca="left">
                        <p>ORF</p>
                     </c>
                     <c ca="left">
                        <p>Function/location</p>
                     </c>
                     <c ca="left">
                        <p>Ref.</p>
                     </c>
                     <c ca="left">
                        <p>Methods</p>
                     </c>
                     <c ca="center">
                        <p># peptides</p>
                     </c>
                     <c ca="center">
                        <p>% Coverage</p>
                     </c>
                  </r>
                  <r>
                     <c cspan="6">
                        <hr/>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A3L</p>
                     </c>
                     <c ca="left">
                        <p>Major core protein</p>
                     </c>
                     <c ca="left">
                        <p>[17]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>39</p>
                     </c>
                     <c ca="center">
                        <p>71.6</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A4L</p>
                     </c>
                     <c ca="left">
                        <p>IMV/P4a associated protein</p>
                     </c>
                     <c ca="left">
                        <p>[18]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>16</p>
                     </c>
                     <c ca="center">
                        <p>49.1</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A5R</p>
                     </c>
                     <c ca="left">
                        <p>RNA pol. subunit</p>
                     </c>
                     <c ca="left">
                        <p>[19]</p>
                     </c>
                     <c ca="left">
                        <p>1,4,5</p>
                     </c>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c ca="center">
                        <p>29.9</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A7L</p>
                     </c>
                     <c ca="left">
                        <p>Early transcription factor</p>
                     </c>
                     <c ca="left">
                        <p>[20]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>7</p>
                     </c>
                     <c ca="center">
                        <p>12.7</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A10L</p>
                     </c>
                     <c ca="left">
                        <p>Major core protein</p>
                     </c>
                     <c ca="left">
                        <p>[21]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>62</p>
                     </c>
                     <c ca="center">
                        <p>64.3</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A12L</p>
                     </c>
                     <c ca="left">
                        <p>Viral structural protein</p>
                     </c>
                     <c ca="left">
                        <p>[22]</p>
                     </c>
                     <c ca="left">
                        <p>1,3,4</p>
                     </c>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="center">
                        <p>14.6</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A13L</p>
                     </c>
                     <c ca="left">
                        <p>Membrane phosphoprotein</p>
                     </c>
                     <c ca="left">
                        <p>[23]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>6</p>
                     </c>
                     <c ca="center">
                        <p>91.4</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A14L</p>
                     </c>
                     <c ca="left">
                        <p>Membrane phosphoprotein</p>
                     </c>
                     <c ca="left">
                        <p>[23]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="center">
                        <p>61.1</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A15L</p>
                     </c>
                     <c ca="left">
                        <p>Core assoc. protein</p>
                     </c>
                     <c ca="left">
                        <p>[24]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3</p>
                     </c>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="center">
                        <p>60.2</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A16L</p>
                     </c>
                     <c ca="left">
                        <p>Myristoylprotein; entry/fusion</p>
                     </c>
                     <c ca="left">
                        <p>[25, 26]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,5</p>
                     </c>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="center">
                        <p>12.2</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A17L</p>
                     </c>
                     <c ca="left">
                        <p>IMV membrane prtn</p>
                     </c>
                     <c ca="left">
                        <p>[27, 28]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="center">
                        <p>32.0</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A24R</p>
                     </c>
                     <c ca="left">
                        <p>RNA pol. subunit</p>
                     </c>
                     <c ca="left">
                        <p>[29]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>26</p>
                     </c>
                     <c ca="center">
                        <p>30.9</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A27L</p>
                     </c>
                     <c ca="left">
                        <p>IMV membrane prtn</p>
                     </c>
                     <c ca="left">
                        <p>[30]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>17</p>
                     </c>
                     <c ca="center">
                        <p>70.0</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A29L</p>
                     </c>
                     <c ca="left">
                        <p>RNA pol. subunit</p>
                     </c>
                     <c ca="left">
                        <p>[31]</p>
                     </c>
                     <c ca="left">
                        <p>2,5</p>
                     </c>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="center">
                        <p>8.2</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A30L</p>
                     </c>
                     <c ca="left">
                        <p>Virion component</p>
                     </c>
                     <c ca="left">
                        <p>[32]</p>
                     </c>
                     <c ca="left">
                        <p>2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c ca="center">
                        <p>58.4</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A33R</p>
                     </c>
                     <c ca="left">
                        <p>EEV glycoprotein</p>
                     </c>
                     <c ca="left">
                        <p>[33]</p>
                     </c>
                     <c ca="left">
                        <p>1,4,5</p>
                     </c>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="center">
                        <p>21.6</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A34R</p>
                     </c>
                     <c ca="left">
                        <p>EEV glycoprotein</p>
                     </c>
                     <c ca="left">
                        <p>[34]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4</p>
                     </c>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="center">
                        <p>23.2</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A42R</p>
                     </c>
                     <c ca="left">
                        <p>Profilin homolog</p>
                     </c>
                     <c ca="left">
                        <p>[35]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>6</p>
                     </c>
                     <c ca="center">
                        <p>51.1</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A46R</p>
                     </c>
                     <c ca="left">
                        <p>Interact with host IL-1</p>
                     </c>
                     <c ca="left">
                        <p>[36]</p>
                     </c>
                     <c ca="left">
                        <p>1</p>
                     </c>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="center">
                        <p>12.6</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>A56R</p>
                     </c>
                     <c ca="left">
                        <p>EEV glycoprtn, hemagglutinin</p>
                     </c>
                     <c ca="left">
                        <p>[37]</p>
                     </c>
                     <c ca="left">
                        <p>1,4,5</p>
                     </c>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c ca="center">
                        <p>12.4</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>B5R</p>
                     </c>
                     <c ca="left">
                        <p>EEV glycoprotein</p>
                     </c>
                     <c ca="left">
                        <p>[38]</p>
                     </c>
                     <c ca="left">
                        <p>4</p>
                     </c>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="center">
                        <p>10.4</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>B22R</p>
                     </c>
                     <c ca="left">
                        <p>Serpin (C16L)</p>
                     </c>
                     <c ca="left">
                        <p>[39]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c ca="center">
                        <p>19.9</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>D1R</p>
                     </c>
                     <c ca="left">
                        <p>Capping enzyme subunit</p>
                     </c>
                     <c ca="left">
                        <p>[40]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>15</p>
                     </c>
                     <c ca="center">
                        <p>22.7</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>D2L</p>
                     </c>
                     <c ca="left">
                        <p>virion component</p>
                     </c>
                     <c ca="left">
                        <p>[41]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>9</p>
                     </c>
                     <c ca="center">
                        <p>63.0</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>D3R</p>
                     </c>
                     <c ca="left">
                        <p>virion component</p>
                     </c>
                     <c ca="left">
                        <p>[41]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>8</p>
                     </c>
                     <c ca="center">
                        <p>50.6</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>D6R</p>
                     </c>
                     <c ca="left">
                        <p>Early transcription factor</p>
                     </c>
                     <c ca="left">
                        <p>[42]</p>
                     </c>
                     <c ca="left">
                        <p>2,5</p>
                     </c>
                     <c ca="center">
                        <p>7</p>
                     </c>
                     <c ca="center">
                        <p>11.9</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>D8L</p>
                     </c>
                     <c ca="left">
                        <p>IMV membrane protein</p>
                     </c>
                     <c ca="left">
                        <p>[43, 44]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>26</p>
                     </c>
                     <c ca="center">
                        <p>89.1</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>D11L</p>
                     </c>
                     <c ca="left">
                        <p>DNA-dependent ATPase</p>
                     </c>
                     <c ca="left">
                        <p>[45]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,5</p>
                     </c>
                     <c ca="center">
                        <p>9</p>
                     </c>
                     <c ca="center">
                        <p>17.3</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>D12L</p>
                     </c>
                     <c ca="left">
                        <p>Capping enzyme subunit</p>
                     </c>
                     <c ca="left">
                        <p>[46]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>8</p>
                     </c>
                     <c ca="center">
                        <p>40.4</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>E1L</p>
                     </c>
                     <c ca="left">
                        <p>PolyA polymerase</p>
                     </c>
                     <c ca="left">
                        <p>[47, 48]</p>
                     </c>
                     <c ca="left">
                        <p>2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="center">
                        <p>11.1</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>E3L</p>
                     </c>
                     <c ca="left">
                        <p>dsRNA dep. protein kinase</p>
                     </c>
                     <c ca="left">
                        <p>[49]</p>
                     </c>
                     <c ca="left">
                        <p>1,5</p>
                     </c>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c ca="center">
                        <p>13.2</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>E4L</p>
                     </c>
                     <c ca="left">
                        <p>RNA polymerase</p>
                     </c>
                     <c ca="left">
                        <p>[50]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="center">
                        <p>27.8</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>
                           <it>E6R</it>
                        </p>
                     </c>
                     <c ca="left">
                        <p>
                           <it>unknown</it>
                        </p>
                     </c>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <it>1,2,4,5</it>
                        </p>
                     </c>
                     <c ca="center">
                        <p>
                           <it>20</it>
                        </p>
                     </c>
                     <c ca="center">
                        <p>
                           <it>43.1</it>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>E8R</p>
                     </c>
                     <c ca="left">
                        <p>Virion component</p>
                     </c>
                     <c ca="left">
                        <p>[51, 52]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>11</p>
                     </c>
                     <c ca="center">
                        <p>57.1</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>E10R</p>
                     </c>
                     <c ca="left">
                        <p>Oxidase</p>
                     </c>
                     <c ca="left">
                        <p>[53]</p>
                     </c>
                     <c ca="left">
                        <p>2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="center">
                        <p>17.9</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>E11L</p>
                     </c>
                     <c ca="left">
                        <p>Viral core protein</p>
                     </c>
                     <c ca="left">
                        <p>[54]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="center">
                        <p>26.4</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>F8L</p>
                     </c>
                     <c ca="left">
                        <p>Cytosolic protein</p>
                     </c>
                     <c ca="left">
                        <p>[55]</p>
                     </c>
                     <c ca="left">
                        <p>3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="center">
                        <p>60.0</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>F9L</p>
                     </c>
                     <c ca="left">
                        <p>Mem. prtn.; similarity to L1R</p>
                     </c>
                     <c ca="left">
                        <p>[53]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,5</p>
                     </c>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="center">
                        <p>22.6</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>F10L</p>
                     </c>
                     <c ca="left">
                        <p>Protein kinase</p>
                     </c>
                     <c ca="left">
                        <p>[56, 57]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,5</p>
                     </c>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="center">
                        <p>15.7</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>F13L</p>
                     </c>
                     <c ca="left">
                        <p>EEV membrane protein</p>
                     </c>
                     <c ca="left">
                        <p>[58]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>9</p>
                     </c>
                     <c ca="center">
                        <p>32.0</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>F17R</p>
                     </c>
                     <c ca="left">
                        <p>DNA binding phosphoprotein</p>
                     </c>
                     <c ca="left">
                        <p>[59]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>9</p>
                     </c>
                     <c ca="center">
                        <p>55.4</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>G1L</p>
                     </c>
                     <c ca="left">
                        <p>metalloproteinase</p>
                     </c>
                     <c ca="left">
                        <p>[60]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>10</p>
                     </c>
                     <c ca="center">
                        <p>19.1</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>G3L</p>
                     </c>
                     <c ca="left">
                        <p>Entry/fusion complex</p>
                     </c>
                     <c ca="left">
                        <p>[61]</p>
                     </c>
                     <c ca="left">
                        <p>2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>6</p>
                     </c>
                     <c ca="center">
                        <p>41.4</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>G4L</p>
                     </c>
                     <c ca="left">
                        <p>glutaredoxin</p>
                     </c>
                     <c ca="left">
                        <p>[62]</p>
                     </c>
                     <c ca="left">
                        <p>2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>11</p>
                     </c>
                     <c ca="center">
                        <p>77.4</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>G7L</p>
                     </c>
                     <c ca="left">
                        <p>Core cmpnnt, partners w/A30L</p>
                     </c>
                     <c ca="left">
                        <p>[63]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>20</p>
                     </c>
                     <c ca="center">
                        <p>59.8</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>H1L</p>
                     </c>
                     <c ca="left">
                        <p>Protein phosphatase</p>
                     </c>
                     <c ca="left">
                        <p>[64]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>10</p>
                     </c>
                     <c ca="center">
                        <p>67.3</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>H3L</p>
                     </c>
                     <c ca="left">
                        <p>Immunodominant protein</p>
                     </c>
                     <c ca="left">
                        <p>[65]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>31</p>
                     </c>
                     <c ca="center">
                        <p>79.0</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>H4L</p>
                     </c>
                     <c ca="left">
                        <p>RNA pol. associated protein</p>
                     </c>
                     <c ca="left">
                        <p>[66]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="center">
                        <p>10.6</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>H5R</p>
                     </c>
                     <c ca="left">
                        <p>Membrane phosphoprotein</p>
                     </c>
                     <c ca="left">
                        <p>[67]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>8</p>
                     </c>
                     <c ca="center">
                        <p>49.3</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>I1L</p>
                     </c>
                     <c ca="left">
                        <p>encapsidated DNA-binding prtn</p>
                     </c>
                     <c ca="left">
                        <p>[68]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>6</p>
                     </c>
                     <c ca="center">
                        <p>20.5</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>I3L</p>
                     </c>
                     <c ca="left">
                        <p>DNA binding phosphoprotein</p>
                     </c>
                     <c ca="left">
                        <p>[69, 70]</p>
                     </c>
                     <c ca="left">
                        <p>2,5</p>
                     </c>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c ca="center">
                        <p>18.6</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>I5L</p>
                     </c>
                     <c ca="left">
                        <p>Virion component</p>
                     </c>
                     <c ca="left">
                        <p>[71]</p>
                     </c>
                     <c ca="left">
                        <p>1,4</p>
                     </c>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="center">
                        <p>94.9</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>I7L</p>
                     </c>
                     <c ca="left">
                        <p>Core protein proteinase</p>
                     </c>
                     <c ca="left">
                        <p>[72]</p>
                     </c>
                     <c ca="left">
                        <p>2</p>
                     </c>
                     <c ca="center">
                        <p>9</p>
                     </c>
                     <c ca="center">
                        <p>18.4</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>I8R</p>
                     </c>
                     <c ca="left">
                        <p>RNA/DNA-dependant NTPase</p>
                     </c>
                     <c ca="left">
                        <p>[73]</p>
                     </c>
                     <c ca="left">
                        <p>4,5</p>
                     </c>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="center">
                        <p>8.7</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>J1R</p>
                     </c>
                     <c ca="left">
                        <p>IMV membrane protein</p>
                     </c>
                     <c ca="left">
                        <p>[74]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="center">
                        <p>30.1</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>J3R</p>
                     </c>
                     <c ca="left">
                        <p>Poly(A) polymerase, RNA methyltransferase</p>
                     </c>
                     <c ca="left">
                        <p>[48, 75]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>14</p>
                     </c>
                     <c ca="center">
                        <p>47.4</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>J4R</p>
                     </c>
                     <c ca="left">
                        <p>RNA polymerase</p>
                     </c>
                     <c ca="left">
                        <p>[76]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4</p>
                     </c>
                     <c ca="center">
                        <p>6</p>
                     </c>
                     <c ca="center">
                        <p>38.4</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>J6R</p>
                     </c>
                     <c ca="left">
                        <p>RNA polymerase</p>
                     </c>
                     <c ca="left">
                        <p>[76]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,4,5</p>
                     </c>
                     <c ca="center">
                        <p>34</p>
                     </c>
                     <c ca="center">
                        <p>33.9</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>K4L</p>
                     </c>
                     <c ca="left">
                        <p>Homolog to VP37, phoshoplipase D</p>
                     </c>
                     <c ca="left">
                        <p>[58, 77]</p>
                     </c>
                     <c ca="left">
                        <p>3,4</p>
                     </c>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="center">
                        <p>8.5</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>L1R</p>
                     </c>
                     <c ca="left">
                        <p>IMV membrane protein</p>
                     </c>
                     <c ca="left">
                        <p>[78]</p>
                     </c>
                     <c ca="left">
                        <p>2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>8</p>
                     </c>
                     <c ca="center">
                        <p>40.8</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>
                           <it>L3L</it>
                        </p>
                     </c>
                     <c ca="left">
                        <p>
                           <it>unknown</it>
                        </p>
                     </c>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <it>1,2,4,5</it>
                        </p>
                     </c>
                     <c ca="center">
                        <p>
                           <it>7</it>
                        </p>
                     </c>
                     <c ca="center">
                        <p>
                           <it>22.9</it>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>L4R</p>
                     </c>
                     <c ca="left">
                        <p>Major core protein</p>
                     </c>
                     <c ca="left">
                        <p>[79]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>25</p>
                     </c>
                     <c ca="center">
                        <p>77.7</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>O2L</p>
                     </c>
                     <c ca="left">
                        <p>Glutaredoxin</p>
                     </c>
                     <c ca="left">
                        <p>[80, 81]</p>
                     </c>
                     <c ca="left">
                        <p>1,2,3,4,5</p>
                     </c>
                     <c ca="center">
                        <p>7</p>
                     </c>
                     <c ca="center">
                        <p>70.4</p>
                     </c>
                  </r>
               </tblbdy>
            </tbl>
         </sec>
         <sec>
            <st>
               <p>Method 1: SDS-PAGE + LC-ESI-Q-TOF MS</p>
            </st>
            <p>SDS-PAGE was employed to partition the core- and membrane-enriched fractions prior to MS analysis. The two protein fractions were resolved on a 12.5% SDS-PAGE gel and stained with Coomassie brilliant blue (Fig <figr fid="F1">1A</figr> and <figr fid="F1">1B</figr>). Each gel was sliced into several sections and each section was subjected to in-gel trypsin digestion as described in the Methods section. The tryptic digests were analyzed by LC-ESI-Q-TOF MS. As a typical example of the kind of data used for peptide identification using MASCOT software, the tandem mass spectrum of a peptide originating from the major core protein, L4R, is shown in Figure <figr fid="F1">1C</figr>. This spectrum was obtained from the tryptic digest of gel slice "h" (Fig. <figr fid="F1">1B</figr>). The full scan mass spectrum shows a peak at m/z 867.9 which represents the doubly charged ion of a peptide with a molecular mass of 1733.8 Da. Tandem MS of the doubly charged ion at m/z 867.9 yielded a fragment ion spectrum displaying eleven C-terminal (y-type) fragment ions and one N-terminal (b-type) fragment ion. Database searching of this tandem mass spectrum identified this peptide as ELESYSSSPLQEPIR, the partial sequence (amino acid [aa] 213&#8211;227) of the L4R protein. This tandem mass spectrum obtained the excellent score of 129. Using this method we obtained 708 spectra, observed 315 peptides and identified 52 proteins.</p>
         </sec>
         <sec>
            <st>
               <p>Method 2: SDS-PAGE + LC-ESI-QIT MS</p>
            </st>
            <p>The tryptic digestions from the excised gel slices were additionally analyzed on an ion trap mass spectrometer (LC-ESI-QIT). Using this platform we identified 53 virion proteins from 1088 spectra corresponding to 417 total peptides. For example, during the mass spectrometric analysis of the tryptic digest of gel slice "d" (Fig. <figr fid="F1">1A</figr>) an ion peak at m/z 831.1 in the full scan mass spectrum was observed (Fig. <figr fid="F2">2C</figr> inset) which corresponds to a doubly charged ion of a peptide with molecular mass 1660.2 Da. The tandem MS of the double charged ion had a good score of 62 and revealed the sequence for a peptide of the E6R protein, LGLVLDDYKGDLLVK (aa 470&#8211;484). Seven C-terminal fragment ions, nine N-terminal fragment ions, and two internal fragments ions (m/z 399.1 [GDLL] and m/z 527.0 [KGDLL]) were observed for this particular peptide. E6R is a vaccinia protein that has not been previously reported.</p>
            <fig id="F2">
               <title>
                  <p>Figure 2</p>
               </title>
               <caption>
                  <p>Mass analysis of a distinct peptide from the E6R protein using Method 2 (SDS-PAGE + LC-ESI-QIT MS)</p>
               </caption>
               <text>
                  <p><b>Mass analysis of a distinct peptide from the E6R protein using Method 2 (SDS-PAGE + LC-ESI-QIT MS) </b>Gel slice "d" from the SDS-PAGE of the core-enriched fraction (Fig. 1A) was subjected to an in-gel trypsin digestion, and analyzed by LC-ESI-QIT MS. The tandem mass spectrum data, correlating to the full scan mass spectrum (inset, doubly charged parent ion at m/z 831.1), reveals a peptide of the E6R protein. Asterisks (*) denote the loss of ammonia (NH<sub>3</sub>) or water (H<sub>2</sub>O).</p>
               </text>
               <graphic file="1743-422X-3-10-2"/>
            </fig>
         </sec>
         <sec>
            <st>
               <p>Method 3: HPLC + LC-ESI-QIT MS</p>
            </st>
            <p>We also employed reverse phase HPLC to fractionate the proteins prior to MS analysis (Fig. <figr fid="F3">3A</figr> is the enriched core fraction and Fig. <figr fid="F3">3B</figr> is the enriched membrane fraction). HPLC separation was well suited for fractionating the soluble proteins, but proved to be more challenging for the insoluble core proteins. The cores did not completely dissolve even when treated with sodium deoxycholate. Approximately 200 &#956;L of sample (as described in the Methods section) was loaded onto a 2 &#215; 150 mm C<sub>4 </sub>reverse phase column, and fractions were collected manually every 2 minutes between 20 and 80 minutes. Each of these fractions was subjected to trypsin digestion prior to analysis by LC-ESI-QIT MS. Using this method we obtained 367 tandem mass spectra that correlated to 131 total peptides yielding 25 distinct vaccinia virion proteins. A representative example is shown in Figure <figr fid="F3">3C</figr>. The membrane sample at 59&#8211;60 minutes (Fig. <figr fid="F3">3B</figr>, brackets) underwent tandem mass spectrometric analysis to reveal a peptide of the well characterized L1R protein. The full scan spectrum for this fraction contained an ion at m/z 1289.7 (Fig. <figr fid="F3">3C</figr>, inset) which was used for tandem mass spectrometry. The fragment ions observed matched the theoretical fragmentation pattern for a peptide of the L1R protein (Fig. <figr fid="F3">3C</figr>) encompassing the sequence LEQEANASAQTK, aa 22&#8211;33. The ions at m/z 534.1, 605.2, 719.3, 790.4, 1047.3, and 1176.5, are the C-terminal fragment ions, while the ions at m/z 756.1, 842.6, 914.1, and 1042.4 are the N-terminal fragments. This spectrum received an acceptable score of 47.</p>
            <fig id="F3">
               <title>
                  <p>Figure 3</p>
               </title>
               <caption>
                  <p>Mass analysis of a distinct peptide from the L1R protein using Method 3 (HPLC + LC-ESI-QIT MS)</p>
               </caption>
               <text>
                  <p><b>Mass analysis of a distinct peptide from the L1R protein using Method 3 (HPLC + LC-ESI-QIT MS). </b>The core- (A) and membrane-enriched (B) fractions were resolved on a C<sub>4 </sub>HPLC column according to the Methods section. Tandem mass spectrometric analysis of fraction 59&#8211;60 (B, indicated by brackets) produced from a singly charged precursor ion (inset, m/z 1289.7), yielded fragment ions which corresponded to a peptide the L1R protein. Asterisks (*) denote the loss of ammonia (NH<sub>3</sub>) or water (H<sub>2</sub>O).</p>
               </text>
               <graphic file="1743-422X-3-10-3"/>
            </fig>
         </sec>
         <sec>
            <st>
               <p>Method 4: LC-ESI-Q-TOF MS</p>
            </st>
            <p>We wanted to analyze the samples without pre-fractionation to compare the data with thegel fractions (method 1 &amp; 2) and HPLC fractions (method 3). Known as a "shotgun" approach, the membrane- and core-enriched fractions were directly digested with trypsin, and analyzed using LC-ESI-Q-TOF MS. This methodology resulted in 319 tandem mass spectra that matched 202 total peptides, and identified 53 virion proteins. One exciting example is the L3L protein (Fig. <figr fid="F4">4</figr>), a protein that has not been reported before. When the parent ion at m/z 844.5 (Fig. <figr fid="F4">4</figr>, inset) was fragmented, four C-terminal, five N-terminal, and four internal fragment ions (m/z 211.1, 302.2, 324.2, and 415.3) were observed. The respective tandem mass spectrum had a score of 59. This data was assigned to the sequence AVGFPLLK (aa 115&#8211;122) of the L3L protein.</p>
            <fig id="F4">
               <title>
                  <p>Figure 4</p>
               </title>
               <caption>
                  <p>Mass analysis of a distinct peptide from the L3L protein using Method 4 (LC-ESI-Q-TOF MS)</p>
               </caption>
               <text>
                  <p><b>Mass analysis of a distinct peptide from the L3L protein using Method 4 (LC-ESI-Q-TOF MS). </b>The core-enriched fraction of the virion was subjected to trypsin digestion, and analyzed by the LC-ESI-Q-TOF mass spectrometer. The full scan mass spectrum displays a peak at m/z 844.5 (inset), and corresponding tandem mass spectrum identifies a peptide of the L3L protein. Four internal fragments were also identified for the L3L peptide including: PL, GFP, PLL, and GFPL.</p>
               </text>
               <graphic file="1743-422X-3-10-4"/>
            </fig>
         </sec>
         <sec>
            <st>
               <p>Method 5: MALDI-TOF/TOF MS</p>
            </st>
            <p>Direct trypsin digests of the membrane- and core-enriched fractions were also analyzed using MALDI-TOF/TOF MS to take advantage of complementary ionization techniques <abbrgrp><abbr bid="B7">7</abbr></abbrgrp>. MALDI tandem mass spectrometry generated 234 spectra, correlating to 209 total peptides, and resulting in 55 unique virion protein identifications. Of particular interest is the ion at m/z at 1522.69 in the full scan mass spectrum (Fig. <figr fid="F5">5</figr>, inset). Tandem mass spectral analysis of this ion revealed the peptide HTFNLYDDNDIR, the partial sequence (aa 90&#8211;101) of the G3L protein. The tandem mass spectral analysis yielded six C-terminal, and 4 N-terminal fragment ions (Fig. <figr fid="F5">5</figr>), and obtained an average score of 41.</p>
            <fig id="F5">
               <title>
                  <p>Figure 5</p>
               </title>
               <caption>
                  <p>Mass analysis of a distinct peptide from the G3L protein using Method 5 (MALDI-TOF/TOF)</p>
               </caption>
               <text>
                  <p><b>Mass analysis of a distinct peptide from the G3L protein using Method 5 (MALDI-TOF/TOF). </b>The membrane-enriched fraction of the virion was subjected to trypsin digest, and analyzed by MALDI-TOF/TOF MS. The full scan mass spectrum yielded a singly charged ion at m/z 1522.69 (inset). Tandem mass spectrum of the parent ion corresponds to a peptide of G3L. Asterisks (*) denote the loss of ammonia (NH<sub>3</sub>) or water (H<sub>2</sub>O).</p>
               </text>
               <graphic file="1743-422X-3-10-5"/>
            </fig>
         </sec>
         <sec>
            <st>
               <p>New vaccinia virus proteins</p>
            </st>
            <p>This comprehensive study of the vaccinia virion revealed two newly observed proteins. Each of these proteins (E6R and L3L) has not been described previously. The peptides detected for each of these proteins are listed in Tables <tblr tid="T2">2</tblr> and <tblr tid="T3">3</tblr>.</p>
            <tbl id="T2">
               <title>
                  <p>Table 2</p>
               </title>
               <caption>
                  <p>Amino acid sequence of the VV protein E6R and identified peptides Peptides detected from the Method 1 (SDS-PAGE + LC-ESI-Q-TOF MS), Method 2 (SDS-PAGE + LC-ESI-QIT MS), Method 3 (HPLC + LC-ESI-QIT MS), Method 4 (LC-ESI-Q-TOF MS), and Method 5 (MALDI-TOF/TOF MS) are denoted with an asterisk (*). Peptides that are in bold print have been identified by at least one of the five methods.</p>
               </caption>
               <tblbdy cols="2">
                  <r>
                     <c ca="center">
                        <p>Method</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>MDFIRRK<b>YLIYTVENNIDFLKDDTLSKVNNFTLNHVLALKYLVSNFPQHV</b></monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;***********************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;********************&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;**********</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace><b>ITK</b>DVLANTNFFVFIHMVRCCKVYEAVLR<b>HAFDAPTLYVK</b>ALTKNYLSFS</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>***&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;***********</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>***&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;***********</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>NAIQSYKETVHKLTQDEK<b>FLEVAEYMDELGELIGVNYDLVLNPLFHGGEP</b></monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;********************************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace><b>IK</b>DMEIIFLKLFKKTDFKVVKKLSVIRLLIWAYLSKK<b>DTGIEFADNDRQD</b></monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;*************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>**</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;**</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace><b>IYTLFQQTGRIVHSNLTETFRDYIFPGDK</b>TSYWVWLNESIANDADIVLNR</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>**********</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;********</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>*********************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace><b>HAITMYDK</b>ILSYIYSEIKQGRVNKNMLK<b>LVYIFEPEKDIR</b>ELLLEIIYDI</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>********</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>PGDILSIIDAKNDDWKKYFISFYKANFINGNTFISDR<b>TFNEDLFRVVVQI</b></monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;*****</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;********</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;********</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;*****</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace><b>DPEYFDNERIMSLFSTSAADIK</b>RFDELDINNSYISNIIYEVNDITLDTMD</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>**********************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>*********</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>DMKKCQIFNEDTSYYVKEYNTYLFLHESDPMVIENGILKKLSSIKSKSKR</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace><b>LNLFSK</b>NILKYYLDGQLAR<b>LGLVLDDYKGDLLVKMINHLKSVEDVSAFVR</b></monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;***************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>******&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;*******************************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>FSTDKNPSILPSLIKTILASYNISIIVLFQRFLR<b>DNLYHVEEFLDK</b>SIHL</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>TKTDKK<b>YILQLIR</b>HGRS</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;*******</monospace>
                        </p>
                     </c>
                  </r>
               </tblbdy>
            </tbl>
            <tbl id="T3">
               <title>
                  <p>Table 3</p>
               </title>
               <caption>
                  <p>Amino acid sequence of the VV protein L3L and identified peptides Peptides detected from the Method 1 (SDS-PAGE + LC-ESI-Q-TOF MS), Method 2 (SDS-PAGE + LC-ESI-QIT MS), Method 3 (HPLC + LC-ESI-QIT MS), Method 4 (LC-ESI-Q-TOF MS), and Method 5 (MALDI-TOF/TOF MS) are denoted with an asterisk (*). Peptides that are in bold print have been identified by at least one of the five methods.</p>
               </caption>
               <tblbdy cols="2">
                  <r>
                     <c ca="center">
                        <p>Method</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>MNTR<b>TDVTNDNIDKNPTK</b>RGDRNIPGRNERFNDQNRFNNDRPRPKPRLQP</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;**************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;**************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;**************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>NQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEM</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>SCWSELSSLVRSRK<b>AVGFPLLK</b>AAKRISHGSMLYFEQLKNSKVVKLTPQV</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;********</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>KCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFN</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>ICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARR<b>GYEHSNYFFEW</b></monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;***********</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace><b>LIKNHISLLTKQTMDILK</b>VKKKYATGAPVNRLLEPGTLVYVPKEDYYFIG</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;***************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;*******</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>***</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>ISLTDVSISDNVR<b>VLFSTDGIVLEIEDFNIKHLFMAGEMFVR</b>SQSSTIIV</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>1</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>2</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>3</p>
                     </c>
                     <c>
                        <p/>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>4</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;******************</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>5</p>
                     </c>
                     <c ca="left">
                        <p>
                           <monospace>&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;*****************************</monospace>
                        </p>
                     </c>
                  </r>
               </tblbdy>
            </tbl>
            <p>The E6R ORF is situated between the E5R and E7R genes and produces a 567 amino acid protein. The predicted molecular mass and pI of E6R is 66,670 Da and 6.16, respectively. E6R was identified in fraction "d" of figure <figr fid="F1">1A</figr>, which corresponds to its predicted molecular weight. Blast searches revealed high homology to orthopoxvirus proteins <abbrgrp><abbr bid="B9">9</abbr></abbrgrp>. Hydrophobicity plots revealed no specific region of interest <abbrgrp><abbr bid="B10">10</abbr></abbrgrp>. We observed 19 peptides from the E6R protein with a confidence scoring range of 17&#8211;85. The identified peptides covered 43.1% of the protein (Table <tblr tid="T2">2</tblr>).</p>
            <p>We observed 7 peptides for L3L covering 22.9% of the sequence (Table <tblr tid="T3">3</tblr>). The L3L protein has a predicted molecular mass of 40.6 kDa (350 amino acids), and a predicted pI of 8.91. Its ORF is situated between the L2R and L4R genes. This protein was identified in fraction "e" and "f" of Figure <figr fid="F1">1A</figr>. Only poxvirus proteins had homology to the L3L sequence resulting from Blast searches <abbrgrp><abbr bid="B9">9</abbr></abbrgrp>, and hydrophobicity plots revealed no specific region of interest <abbrgrp><abbr bid="B10">10</abbr></abbrgrp>.</p>
            <p>Both proteins were found in samples from the core-enriched fractions of Method 1, 2, 4, and 5. No peptides from either protein were found in the membrane-enriched fractions.</p>
         </sec>
      </sec>
      <sec>
         <st>
            <p>Discussion</p>
         </st>
         <p>The goal of this study was to obtain a comprehensive proteomic analysis of the Copenhagen strain of the vaccinia virus virion. This strain of VV was chosen because it is an important model strain for variola, and it has been completely sequenced.</p>
         <p>One concern we had was that the predominant proteins would eclipse the smaller or less abundant proteins when analyzed by MS. In order to overcome this problem we fractionated the virion into soluble (membrane) and insoluble (core) fractions via treatment with detergent and centrifugation. Further fractionation was achieved using two procedures: SDS-PAGE and HPLC. The resolution of viral proteins by SDS-PAGE followed by in-gel trypsin digestion of gel slices and tandem mass analysis (LC-ESI-QIT MS) for protein identification had been used successfully before on other VV proteins <abbrgrp><abbr bid="B11">11</abbr></abbrgrp>. A second MS analysis was done in parallel with these samples using LC-ESI-Q-TOF MS. Although both instruments use the same ionization techniques, the mass analyzers are different. Both mass spectrometers identified 49&#8211;52 proteins using this procedure, however, the proteins identified differed (Fig. <figr fid="F6">6</figr>). Complementary to SDS-PAGE for protein fractionation, reverse phase HPLC was used (Method 3). Due to the encountered difficulties with the insolubility of the viral cores, only the major core proteins were identified (A3L and A10L) from the core-enriched fraction, resulting in a low total number of proteins identified with this procedure (25 versus 49&#8211;54 for the other methods, Fig. <figr fid="F6">6</figr>). Support for this notion is obtained by the study reported by Zachertowska, <it>et al</it>. in which the pooling of fractions from 5 HPLC runs resulted in the identification of only 6 proteins of the myxoma virion <abbrgrp><abbr bid="B12">12</abbr></abbrgrp>. Recognizing this limitation we utilized multiple methods to obtain a more comprehensive catalog of the virion constituents. In order to complete this study, we felt it important to analyze the membrane- and core-enriched samples without separation prior to trypsin digestion. We used two different mass spectrometers to analyze the in-solution digests: MALDI-TOF/TOF MS and LC-ESI-Q-TOF MS. This "shotgun" strategy resulted in a lower number of total spectra and identified a lower number of peptides, but yielded a comparable number of protein identifications (54 and 52, respectively, Fig. <figr fid="F6">6</figr>).</p>
         <fig id="F6">
            <title>
               <p>Figure 6</p>
            </title>
            <caption>
               <p>Diagram of proteins identified using multiple methods</p>
            </caption>
            <text>
               <p><b>Diagram of proteins identified using multiple methods. </b>All overlaps are shown for all five methods: Method 1 - SDS-PAGE + LC-ESI-Q-TOF MS (dashed line); Method 2 - SDS-PAGE + LC-ESI-QIT MS (double line); Method 3 -HPLC + LC-ESI-QIT MS (solid line); Method 4 - LC-ESI-Q-TOF MS (dotted line); and Method 5 - MALDI-TOF/TOF (triple line). Numbers represent the number of shared proteins in overlapping areas. The total number of proteins identified for the method and the percent of total proteins identified is listed.</p>
            </text>
            <graphic file="1743-422X-3-10-6"/>
         </fig>
         <p>A summary of the number of proteins found versus the method used to detect them is shown in Figure <figr fid="F6">6</figr>. There is a high degree of overlap between the methods; noteworthy is that 15 proteins were identified by all 5 methods. Another 20 proteins were identified using methods 1, 2, 4, and 5; this is most likely due to the lack of data for the core-enriched fraction using the HPLC pre-separation procedure (method 3). The majority of the VV proteins identified in this study were observed in 3 or more methods (85.7%), underscoring the complementarity of the different approaches used.</p>
         <p>The current functional annotation of the VV genome is described in the following articles: a minireview by Paoletti, <it>et al </it><abbrgrp><abbr bid="B4">4</abbr></abbrgrp>, describing an update on the vaccinia genome, and the Poxviridae chapter in Fields Virology written by Bernard Moss <abbrgrp><abbr bid="B3">3</abbr></abbrgrp>. Both of these articles describe the organization of the entire genome of the vaccinia virion, and the known functionality of the various vaccinia proteins. Moss describes there being 47 known ORFs that express proteins of the vaccinia virion including membrane proteins as well as core constituents. It is interesting to note that we found 41 of the known virion components. Of the 25 non-enzymatic components only one was not identified &#8211; the D13L protein which has been linked to rifampicin resistance. Of the 22 enzymatic virion components 17 were identified in this study. Two of the missed proteins include D7R and G5.5R which are the two smallest subunits of the RNA polymerase. Although these two components were not identified, the other six RNA polymerase subunits were identified (A5R, A24R, A29L, E4L, J4R and J6R). The remaining three known virion enzymes that were not identified in this study include: A18R (DNA-dependent ATPase), B1R (Protein Kinase 1) and H6R (DNA Topoisomerase 1). Several factors might contribute to the lack of data for these proteins including: the size of the protein, the hydrophobicity of a protein, and the absolute amount of a protein in the virion. In general, very hydrophobic proteins and low abundance proteins are commonly underrepresented in proteomic-type studies. Also, very small proteins are frequently missed. In an effort to overcome at least in part these inherent limitations of comprehensive proteomic studies, we combined different protein fractionation methods with "shotgun" approaches. In addition, to ensure that the highest level of confidence for peptide identification and protein coverage for the current study, the "shotgun" digests were analyzed by two different ionization techniques, ESI and MALDI, taking advantage of the complementarity of these ionization techniques <abbrgrp><abbr bid="B7">7</abbr></abbrgrp>.</p>
         <p>Some recently reported proteins that have been shown to be associated with the core include: A15L, A30L, E11L, G1L, G7L, H1L and J1R &#8211; all of which were identified in our analysis. We also found membrane proteins (F9L, F10L, and E8R) and cytosolic proteins (A16L, E10R, F8L, G4L, and I3L). The remaining proteins identified by this study included A42R, A46R, B22R, E3L, and K4L. The types of VV proteins identified in this study are summarized in Figure <figr fid="F7">7</figr>.</p>
         <fig id="F7">
            <title>
               <p>Figure 7</p>
            </title>
            <caption>
               <p>Summary of the functions of the 63 identified VV proteins</p>
            </caption>
            <text>
               <p><b>Summary of the functions of the 63 identified VV proteins. </b>This graph summarizes the 63 VV proteins identified in this study according to their function. These include: core structural proteins (A3L, A4L, A10L, A12L, A14L, and L4R), membrane proteins (A13L, A17L, A27L, A33R, A34R, A56R, B5R, D8L, F9L, F13L, H3L, H5R, J1R, and L1R), transcriptional proteins (A5R, A7L, A24R, A29L, D1R, D6R, D11L, D12L, E1L, E3L, E4L, H4L, I1L, I8R, J3R, J4R, J6R, and K4L), proteins with other functions (A15L, A16L, A30L, A42R, A46R, B22R, D2L, D3R, E8R, E10R, E11L, F8L, F10L, F17R, G1L, G3L, G4L, G7L, H1L, I3L, I5L, I7L, and O2L), and the unknown proteins (E6R and L3L).</p>
            </text>
            <graphic file="1743-422X-3-10-7"/>
         </fig>
      </sec>
      <sec>
         <st>
            <p>Conclusion</p>
         </st>
         <p>This study represents the first steps toward a widespread identification of the viral protein constituents that make up the structurally complex VV virion. Although not quantitative, this approach has confirmed the presence of most known virion proteins and identified new viral proteins for the first time. Defining the VV proteome is a significant scientific challenge but successful completion of this goal will be useful for understanding the biology of orthopoxviruses.</p>
      </sec>
      <sec>
         <st>
            <p>Methods</p>
         </st>
         <sec>
            <st>
               <p>Materials</p>
            </st>
            <p>Media and supplements were purchased from Invitrogen (Carlsbad, CA). Dithiothreitol (DTT), Tris, N-ethylmorpholine, trifluoroacetic acid (TFA), formic acid, &#945;-cyano-4-hydroxycinnamic acid (HCCA), guanidine hydrochloride and &#946;-Octylglucopyranoside (OG) were purchased from Sigma (St. Lois, MO). HPLC grade acetonitrile (AcN) was purchased from Fisher Scientific (Pittsburg, PA) and the lyophilized sequencing-grade trypsin from Promega (Madison, WI). General use water was generated by a Milli-Q water purification system (Millipore, Bellerica, MA)</p>
         </sec>
         <sec>
            <st>
               <p>Virion purification and fractionation</p>
            </st>
            <p>Vaccinia virus (Copenhagen strain) was propagated as described by Hruby <it>et al</it><abbrgrp><abbr bid="B13">13</abbr></abbrgrp>, and modified in the following way: ten 150 mm dishes of 80% confluent BSC<sub>40 </sub>cells were infected at a multiplicity of infection of 0.1 plaque forming units (pfu)/cell. The infected cells were harvested and subjected to homogenization. Purified virus was obtained through a side-band-pull from a buoyant sucrose density gradient. This purified virus was pelleted by centrifugation. To obtain the membrane- and core-enriched fractions, a protocol from Spencer, <it>et al</it><abbrgrp><abbr bid="B14">14</abbr></abbrgrp> was modified. The equivalent of three tubes (or thirty 150 mm dishes) was resuspended in 300 &#956;L of buffer (0.8% OG, 50 mM DTT, 50 mM Tris, pH = 8.4). The three tubes containing the pelleted virus were rinsed with another 300 &#956;L of buffer. The total 600 &#956;L was placed in an incubator shaker (New Brunswick, Innova 4300, Edison, NJ) for 1.25 hours, shaking at 200 rpm at 37&#176;C. The sample was centrifuged at 15,000 &#215; g at 4&#176;C for 15 min. The supernatant containing the enriched membrane fraction was extracted leaving the pellet (enriched core fraction) intact.</p>
         </sec>
         <sec>
            <st>
               <p>HPLC (membrane-enriched fraction)</p>
            </st>
            <p>The sample was transferred into a dialysis cassette (Pierce, Slide-A-Lyzer, 3,500 Da molecular weight cut off, MWCO) and dialyzed against 800 mL of 20 mM Tris (pH=8.0) for 2 hours at room temperature, and changed three times. The final dialysis was performed for 16 hours at 4&#176;C. Dialysis was performed to remove as much of the OG as possible. The sample was removed from the cassette, reduced to 500 &#956;L using a speed-vac, and filtered through a 0.2 &#956; syringe filter. The sample was injected onto an HPLC (Waters Breeze system, Milford, MA) using a 500 &#956;L sample loop. A 5 &#956;m C<sub>4 </sub>300 &#197; 2 &#215; 150 mm column (Phenomenex Jupiter, Torrance, CA) was used with a flow rate of 0.2 mL/min. A wavelength absorbance detector (Waters 2487 Dual Absorbance, Milford, MA) was used to detect wavelengths at 214 and 254 nm. Solvent A was composed of 5% AcN, 0.05% TFA in H<sub>2</sub>O and solvent B was composed of 95% AcN, 0.05% TFA in H<sub>2</sub>O. For the membrane-enriched sample the gradient system consisted of 10 min isocratic gradient with 98% of solvent A, 55 min gradient to 2% A, and 10 min isocratic gradient with 2%. Fractions were collected in 5 minute intervals for the first 20 min and then in 2 min intervals for 60 min. The final 7 min was collected in one final fraction. A speed-vac was used to decrease the volume of the fractions to about 5&#8211;10 &#956;L. The pH was adjusted with 50 mM Tris (pH = 9.6) or N-ethylmorpholine to between 7.0 and 8.5. For the trypsin digest 1.5 &#956;L of trypsin (1 &#956;g/&#956;L, Promega, Madison, WI) was added to each fraction. The fractions were incubated overnight at 37&#176;C.</p>
         </sec>
         <sec>
            <st>
               <p>HPLC (core-enriched fraction)</p>
            </st>
            <p>The core-enriched fraction was dissolved prior to injection on the HPLC <abbrgrp><abbr bid="B12">12</abbr></abbrgrp>. Briefly, this was carried out by resuspending the insoluble pellet from the virion fractionation in 0.4% sodium deoxycholate and 10 mM Tris, pH = 9.0, and incubating at 56&#176;C for 10 min. The sample was filtered and injected onto the HPLC system as described above. For the core-enriched sample the gradient system consisted of a 10 min isocratic gradient with 98% of solvent A, 40 min gradient to 25%A, 30 min gradient to 2% A, and a 10 min isocratic gradient with 2% A. Fractions were collected as outlined above.</p>
         </sec>
         <sec>
            <st>
               <p>SDS-PAGE</p>
            </st>
            <p>Virion fractions were mixed with equal amounts of SDS-PAGE loading buffer and resolved on SDS-PAGE gels (12.5%) <abbrgrp><abbr bid="B15">15</abbr></abbrgrp>. The protein bands were visualized using a filtered Coomassie stain (40% methanol, 10% acetic acid and 0.2% Coomassie brilliant blue R-250). Protein bands were excised and the preparation for in-gel digestion <abbrgrp><abbr bid="B16">16</abbr></abbrgrp> was as follows: sample bands from coomassie stained were manually excised, and placed in 0.5 mL Eppendorf tubes. The gel pieces were de-stained with acetic acid:ethanol:H<sub>2</sub>O in a 1:3:6 (v/v/v) ratio for 12&#8211;16 hours under gentle agitation. The gel slices were dehydrated with AcN (vortexed for 10 min), and re-hydrated with 50 mM ammonium bicarbonate (vortexed for 10 min). This procedure was repeated twice, and a final dehydration was performed with AcN. After vortexing any remaining liquid was removed by pipette and the gel slices were dried with a speed vac for 5 minutes.</p>
         </sec>
         <sec>
            <st>
               <p>In-gel trypsin digestion</p>
            </st>
            <p>To each tube containing gel slices 10&#8211;40 &#956;L of 20 &#956;g/&#956;L Promega trypsin in 25&#8211;50 mM Tris-HCl, pH = 8.0 was added. The tubes were incubated on ice for 35&#8211;40 min. After the enzyme solution was fully absorbed, the excess solution was removed and replaced with 10 mM Tris-HCl, pH = 8.0, enough to fully cover each gel slice. Each sample was incubated at 37&#176;C for 12&#8211;16 hours. Any non-absorbed solution was placed in a new tube. The peptides were extracted from the gel by vortexing with 30&#8211;70 &#956;L of 50% AcN/5% formic acid. The extraction fluid was added to the previously removed non-absorbed solution and concentrated to 10&#8211;15 &#956;L.</p>
         </sec>
         <sec>
            <st>
               <p>In-solution trypsin digestion</p>
            </st>
            <p>Samples from the HPLC or from the membrane-enriched fraction were subjected to in-pot trypsin digest by adding a 1:7 ratio of enzyme (1 &#956;g/&#956;L):protein and incubating at 37&#176;C for 12&#8211;16 hours. Because the core-enriched fraction contained an intact protein ''shell'' the following was conducted in order to solubilize the proteins for trypsin digestion. The pellet from the virion fractionation was resuspended in 200 &#956;L of 50 mM Tris (pH = 8.4), and 6 M guanidine HCl. This solution was brought to 90&#176;C for 5 minutes, and after the protein was dissolved, the mixture was diluted with 2.8 mL of H<sub>2</sub>0. Dialysis was performed with a Slide-A-Lyzer (3,500 MWCO) membrane against 800 mL of 20 mM Tris-HCl (pH = 8.0). The buffer was changed 3 times in 24 hours. As the guanidine HCl dialyzed out of the protein solution the proteins precipitated resulting a fluffy white precipitate. However, when this solution was treated with trypsin (as outlined above) the precipitate dissolved indicating that the trypsin cleaved the proteins into various peptides.</p>
         </sec>
         <sec>
            <st>
               <p>LC-ESI-QIT MS</p>
            </st>
            <p>An electrospray ionization quadrupole ion trap mass spectrometer (Finnigan LCQ, San Jose, CA) equipped with a Waters (Milford, MA) 515 HPLC system and LC Packings Accurate Flow Splitter was used. Ten microliters of the tryptic digest was loaded on a C<sub>18 </sub>trap and a C<sub>18 </sub>column (0.17 &#215; 10 mm, Jupiter 5 &#956;, 300 &#197;, packed in-house). HPLC was performed with a gradient from 90% solvent A (0.1% formic acid, 0.005% TFA, in 5% AcN) to 90% solvent B (0.1% formic acid, 0.005% TFA in 95% AcN) over 60 minutes. The full mass spectra (m/z 400 to 2000) and tandem MS (m/z 200 to 2000) spectra were acquired alternately with a dynamic exclusion of 1 min and the peptide was excluded for 1.5 min.</p>
         </sec>
         <sec>
            <st>
               <p>LC-ESI-Q-TOF MS</p>
            </st>
            <p>Five microliters of the tryptic digest sample was mixed with 5 &#956;L of solvent A (0.1% formic acid, 0.005% TFA, and 3% AcN in H<sub>2</sub>O). Five microliters of this solution was loaded for mass analysis. The HPLC was performed on a Waters CapLC system with a flow rate of 300 nL/min in conjunction with a Symmetry 300, C<sub>18, </sub>5 &#956;m trap from Waters (Milford, MA) and a 15 cm long, 75 &#956;m inner diameter PicoFrit column from New Objective (Woburn, MA) packed in-house with Jupiter C<sub>18 </sub>particles from Phenomenex (Torrance, CA). The gradient program began with 3% B (0.1% formic acid, 0.005% TFA in 90% AcN) for 5 min to wash the sample, followed by a gradient up to 30 % B over 40 min, to 50 % B at 60 min, to 70% B at 65 min, and held at 90% B from 70 to 78 min. The LC-ESI-Q-TOF mass spectrometer (Global Ultima; Micromass, Ltd., Manchester, UK) was used with a spray voltage of 3.5 kV. The MS/MS data was recorded using a 0.5 sec MS survey scan and 2.5 sec MS/MS scans on the three most abundant ions found in the survey scan. The CID energy was between 25 and 65 eV depending on the mass and charge state of the precursor ions.</p>
         </sec>
         <sec>
            <st>
               <p>MALDI-TOF/TOF MS</p>
            </st>
            <p>The in-pot tryptic digest sample was loaded on a Symmetry 300 C<sub>18 </sub>trap and a 150 mm by 0.32 mm Symmetry column both packed with 5 &#956;m C<sub>18 </sub>particles from Waters for off-line HPLC separation before the mass analysis. The same gradient was used as in the LC-ESI-Q-TOF MS with solvent A (0.1% TFA and 1% AcN in H<sub>2</sub>O) and solvent B (0.1% TFA and 1% H<sub>2</sub>O in AcN) with a flow rate of 3 &#956;L/min from a Waters CapLC system. The elutant from the column was automatically mixed with 1 &#956;L/min of 0.6 mg/mL HCCA and 0.08 mg/mL ammonium phosphate in 50:50 AcN:H<sub>2</sub>O containing 0.1% TFA. The sample was passed through a 75 &#956;m capillary at a combined rate of 4 &#956;L/min into a Waters MALDIprep sprayer (Life Sciences R &amp; D Laboratory, Waters Corporation). A spotting time of 45 second per spot, a nitrogen flow rate of 7 psi, and a temperature gradient of -2&#176;C/7 min (65&#176;C to 45&#176;C over 90 min) was used. For MALDI tandem mass spectrometry an Applied Biosystems 4700 proteomics Analyzer (Applied Biosystem, Inc., Framingham, MA) was used. MS data were acquired using the reflector mode. Ten tandem mass spectra were recorded from each spot. Ions with a signal to noise (S/N) ration greater than 30 were chosen for tandem mass spectrometry. The tandem mass spectra were recorded by accelerating the precursor ions to 8 keV, selecting with the timed gate set to 3 Da, and performing the collision induced dissociation (CID) at 1 keV. The gas pressure (air) in the CID cell was at 6 &#215; 10<sup>-7 </sup>Torr and the fragment ions were accelerated to 14 keV before entering the reflector.</p>
         </sec>
         <sec>
            <st>
               <p>Data Analysis</p>
            </st>
            <p>Mascot (Matrix Science, London, UK) software was used for the protein identification. The uninterpreted tandem mass spectral data were searched against a VV protein database created in-house based on the complete DNA sequence of vaccinia virus (PUBMED 2219722). Specifically, 273 protein sequences in FASTA format were organized and loaded onto the in-house Mascot primary sequence database. All MS data was also searched against the MSDB database, a composite, non-identical protein sequence database built from a number of primary source databases (Matrix Science). The LC-ESI-QIT MS data was converted into Sequest DTA files and searched with the Mascot program.</p>
         </sec>
      </sec>
      <sec>
         <st>
            <p>Competing interests</p>
         </st>
         <p>The author(s) declare that there are no competing interests.</p>
      </sec>
      <sec>
         <st>
            <p>Authors' contributions</p>
         </st>
         <p>JDY conceived of the study, participated in its design and coordination, assisted with sample preparation, and drafted the manuscript. CRG assisted with the propagation of virus, prepared the samples for analysis, and helped analyze the mass spectrometry data. TSC prepared samples for analysis, analyzed the mass spectrometry data and helped to draft the manuscript. SV assisted with the analysis of the mass spectrometry data. DEH and CSM coordinated the research efforts and edited the manuscript. All authors read and approved the final manuscript.</p>
      </sec>
   </bdy>
   <bm>
      <ack>
         <sec>
            <st>
               <p>Acknowledgements</p>
            </st>
            <p>This work was supported by National Institutes of Health grants AI2335 and AI059331. This publication was also made possible in part by grant P30 ES00210 from the National Institutes of Environmental Health Sciences, NIH.</p>
            <p>Special thanks to Gabriela Morin for her assistance with propagating and purifying the vaccinia virus for this project. We would also like to thank Elizabeth Barofsky and Brian Arbogast for their assistance with the MALDI-TOF/TOF MS, LC-ESI-Q-TOF MS, and LC-ESI-QIT MS.</p>
         </sec>
      </ack>
      <refgrp>
         <bibl id="B1">
            <title>
               <p>Potential biological weapons threats.</p>
            </title>
            <aug>
               <au>
                  <snm>Kortepeter</snm>
                  <fnm>MG</fnm>
               </au>
               <au>
                  <snm>Parker</snm>
                  <fnm>GW</fnm>
               </au>
            </aug>
            <source>Emerg Infect Dis</source>
            <pubdate>1999</pubdate>
            <volume>5</volume>
            <fpage>523</fpage>
            <lpage>527</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">10458957</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B2">
            <title>
               <p>The complete DNA sequence of vaccinia virus</p>
            </title>
            <aug>
               <au>
                  <snm>Goebel</snm>
                  <fnm>SJ</fnm>
               </au>
               <au>
                  <snm>Johnson</snm>
                  <fnm>GP</fnm>
               </au>
               <au>
                  <snm>Perkus</snm>
                  <fnm>ME</fnm>
               </au>
               <au>
                  <snm>Davis</snm>
                  <fnm>SW</fnm>
               </au>
               <au>
                  <snm>Winslow</snm>
                  <fnm>JP</fnm>
               </au>
               <au>
                  <snm>Paoletti</snm>
                  <fnm>E</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1990</pubdate>
            <volume>179</volume>
            <fpage>247</fpage>
            <lpage>266</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/0042-6822(90)90294-2</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B3">
            <title>
               <p>Poxviridae: The Viruses and Their Replication</p>
            </title>
            <aug>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Fields Virology</source>
            <publisher>Philadelphia , Lippincott-Raven</publisher>
            <editor>Fields BN</editor>
            <edition>3rd Edition</edition>
            <pubdate>1996</pubdate>
            <volume>Volume 2</volume>
            <fpage>2637</fpage>
            <lpage>2671</lpage>
         </bibl>
         <bibl id="B4">
            <title>
               <p>An update on the vaccinia virus genome.</p>
            </title>
            <aug>
               <au>
                  <snm>Johnson</snm>
                  <fnm>GP</fnm>
               </au>
               <au>
                  <snm>Goebel</snm>
                  <fnm>SJ</fnm>
               </au>
               <au>
                  <snm>Paoletti</snm>
                  <fnm>E</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1993</pubdate>
            <volume>196</volume>
            <fpage>381</fpage>
            <lpage>401</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1006/viro.1993.1494</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B5">
            <title>
               <p>Identification of the major membrane and core proteins of vaccinia virus by two-dimensional electrophoresis</p>
            </title>
            <aug>
               <au>
                  <snm>Jensen</snm>
                  <fnm>O</fnm>
               </au>
               <au>
                  <snm>Houthaeve</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Shevchenko</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Cudmore</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Ashford</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Mann</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Griffiths</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Locker</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>Journal of Virology</source>
            <pubdate>1996</pubdate>
            <volume>70</volume>
            <issue>11</issue>
            <fpage>7485</fpage>
            <lpage>7497</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">190816</pubid>
                  <pubid idtype="pmpid" link="fulltext">8892867</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B6">
            <title>
               <p>Identification by mass spectroscopy of three major early proteins associated with virosomes in vaccinia virus-infected cells</p>
            </title>
            <aug>
               <au>
                  <snm>Murcia-Nicolas</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Bolbach</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Blais</snm>
                  <fnm>JC</fnm>
               </au>
               <au>
                  <snm>Beaud</snm>
                  <fnm>G</fnm>
               </au>
            </aug>
            <source>Virus Res</source>
            <pubdate>1999</pubdate>
            <volume>59</volume>
            <issue>1</issue>
            <fpage>1</fpage>
            <lpage>12</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/S0168-1702(98)00114-2</pubid>
                  <pubid idtype="pmpid" link="fulltext">10854161</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B7">
            <title>
               <p>Complementary use of MALDI and ESI for the HPLC-MS/MS Analysis of DNA-binding proteins.</p>
            </title>
            <aug>
               <au>
                  <snm>Stapels</snm>
                  <fnm>MD</fnm>
               </au>
               <au>
                  <snm>Barofsky</snm>
                  <fnm>DF</fnm>
               </au>
            </aug>
            <source>Anal Chem</source>
            <pubdate>2004</pubdate>
            <volume>76</volume>
            <fpage>5423</fpage>
            <lpage>5430</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1021/ac030427z</pubid>
                  <pubid idtype="pmpid" link="fulltext">15362902</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B8">
            <title>
               <p>Concentration of, and SDS removal from proteins isolated from multiple two-dimensional electrophoresis gels.</p>
            </title>
            <aug>
               <au>
                  <snm>Dainese Hatt</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Quadroni</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Staudenmann</snm>
                  <fnm>W</fnm>
               </au>
               <au>
                  <snm>James</snm>
                  <fnm>P</fnm>
               </au>
            </aug>
            <source>Eur J Biochem</source>
            <pubdate>1997</pubdate>
            <volume>246</volume>
            <issue>2</issue>
            <fpage>336</fpage>
            <lpage>343</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1111/j.1432-1033.1997.00336.x</pubid>
                  <pubid idtype="pmpid">9208922</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B9">
            <title>
               <p>Gapped BLAST and PSI-BLAST: a new generation of protein database search programs</p>
            </title>
            <aug>
               <au>
                  <snm>Altschul</snm>
                  <fnm>SF</fnm>
               </au>
               <au>
                  <snm>Madden</snm>
                  <fnm>TL</fnm>
               </au>
               <au>
                  <snm>Schaffer</snm>
                  <fnm>AA</fnm>
               </au>
               <au>
                  <snm>Zhang</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Zhang</snm>
                  <fnm>Z</fnm>
               </au>
               <au>
                  <snm>Miller</snm>
                  <fnm>W</fnm>
               </au>
               <au>
                  <snm>Lipman</snm>
                  <fnm>DJ</fnm>
               </au>
            </aug>
            <source>Nucleic Acids Res</source>
            <pubdate>1997</pubdate>
            <volume>25</volume>
            <fpage>3389</fpage>
            <lpage>3402</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">146917</pubid>
                  <pubid idtype="pmpid" link="fulltext">9254694</pubid>
                  <pubid idtype="doi">10.1093/nar/25.17.3389</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B10">
            <title>
               <p>A simple method for displayng the hydropathic character of a protein</p>
            </title>
            <aug>
               <au>
                  <snm>Kyte</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Doolittle</snm>
                  <fnm>RF</fnm>
               </au>
            </aug>
            <source>J Mol Biol</source>
            <pubdate>1982</pubdate>
            <volume>157</volume>
            <issue>1</issue>
            <fpage>105</fpage>
            <lpage>132</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/0022-2836(82)90515-0</pubid>
                  <pubid idtype="pmpid" link="fulltext">7108955</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B11">
            <title>
               <p>Sequence independent acylation of the vaccinia virus A-type inclusion protein</p>
            </title>
            <aug>
               <au>
                  <snm>Yoder</snm>
                  <fnm>JD</fnm>
               </au>
               <au>
                  <snm>Chen</snm>
                  <fnm>TS</fnm>
               </au>
               <au>
                  <snm>Hruby</snm>
                  <fnm>DE</fnm>
               </au>
            </aug>
            <source>Biochem</source>
            <pubdate>2004</pubdate>
            <volume>43</volume>
            <issue>26</issue>
            <fpage>8297</fpage>
            <lpage>8302</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1021/bi0360197</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B12">
            <title>
               <p>Characterization of the major capsid proteins of myxoma virus particles using MALDI-TOF mass spectrometry.</p>
            </title>
            <aug>
               <au>
                  <snm>Zachertowska</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Brewer</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Evans</snm>
                  <fnm>DH</fnm>
               </au>
            </aug>
            <source>J Virol Methods</source>
            <inpress/>
         </bibl>
         <bibl id="B13">
            <title>
               <p>Vaccinia virus replication. I. Requirement for host-cell nucleus</p>
            </title>
            <aug>
               <au>
                  <snm>Hruby</snm>
                  <fnm>DE</fnm>
               </au>
               <au>
                  <snm>Guarino</snm>
                  <fnm>LA</fnm>
               </au>
               <au>
                  <snm>Kates</snm>
                  <fnm>JR</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1979</pubdate>
            <volume>29</volume>
            <fpage>705</fpage>
            <lpage>715</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">353202</pubid>
                  <pubid idtype="pmpid">107327</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B14">
            <title>
               <p>Purification and properties of vaccinia virus DNA-dependent RNA polymerase.</p>
            </title>
            <aug>
               <au>
                  <snm>Spencer</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Shuman</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Hurwitz</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>J Biol Chem</source>
            <pubdate>1980</pubdate>
            <volume>255</volume>
            <fpage>5388</fpage>
            <lpage>5395</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">6768739</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B15">
            <title>
               <p>Cleavage of structural proteins during the assembly of the head of bacteriophage T4.</p>
            </title>
            <aug>
               <au>
                  <snm>Laemmli</snm>
                  <fnm>UK</fnm>
               </au>
            </aug>
            <source>Nature</source>
            <pubdate>1970</pubdate>
            <volume>227</volume>
            <issue>259</issue>
            <fpage>680</fpage>
            <lpage>685</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1038/227680a0</pubid>
                  <pubid idtype="pmpid">5432063</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B16">
            <title>
               <p>Mass spectrometric sequencing of proteins silver-stained polyacrylamide gels.</p>
            </title>
            <aug>
               <au>
                  <snm>Shevchenko</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Wilm</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Vorm</snm>
                  <fnm>O</fnm>
               </au>
               <au>
                  <snm>Mann</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>Anal Chem</source>
            <pubdate>1996</pubdate>
            <volume>68</volume>
            <issue>5</issue>
            <fpage>850</fpage>
            <lpage>858</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1021/ac950914h</pubid>
                  <pubid idtype="pmpid">8779443</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B17">
            <title>
               <p>Transcriptional and translational mapping and nucleotide sequence analysis of a vaccinia virus gene encoding the precursor of the major core polypeptide 4b.</p>
            </title>
            <aug>
               <au>
                  <snm>Rosel</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1985</pubdate>
            <volume>56</volume>
            <issue>3</issue>
            <fpage>830</fpage>
            <lpage>838</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">252654</pubid>
                  <pubid idtype="pmpid">2999438</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B18">
            <title>
               <p>Identification and characterization of vaccinia virus genes encoding proteins that are highly antigenic in animals and are immunodominant in vaccinated humans.</p>
            </title>
            <aug>
               <au>
                  <snm>Demkowicz</snm>
                  <fnm>WE</fnm>
               </au>
               <au>
                  <snm>Maa</snm>
                  <fnm>JS</fnm>
               </au>
               <au>
                  <snm>Esteban</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1992</pubdate>
            <volume>66</volume>
            <issue>1</issue>
            <fpage>386</fpage>
            <lpage>398</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">238298</pubid>
                  <pubid idtype="pmpid">1727494</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B19">
            <title>
               <p>Identification and expression of rpo19, a vaccinia virus gene encoding a 19-kilodalton DNA-dependent RNA polymerase subunit.</p>
            </title>
            <aug>
               <au>
                  <snm>Ahn</snm>
                  <fnm>BY</fnm>
               </au>
               <au>
                  <snm>Rosel</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Cole</snm>
                  <fnm>NB</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1992</pubdate>
            <volume>66</volume>
            <issue>2</issue>
            <fpage>971</fpage>
            <lpage>982</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">240799</pubid>
                  <pubid idtype="pmpid">1731116</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B20">
            <title>
               <p>Early transcription factor subunits are encoded by vaccinia virus late genes.</p>
            </title>
            <aug>
               <au>
                  <snm>Gershon</snm>
                  <fnm>PD</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Proc Natl Aca Sci</source>
            <pubdate>1990</pubdate>
            <volume>87</volume>
            <issue>11</issue>
            <fpage>4401</fpage>
            <lpage>4405</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1073/pnas.87.11.4401</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B21">
            <title>
               <p>Fine structure of the vaccinia virus gene encoding the precursor of the major core protein 4a.</p>
            </title>
            <aug>
               <au>
                  <snm>Van Meir</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Wittek</snm>
                  <fnm>R</fnm>
               </au>
            </aug>
            <source>Arch Virol</source>
            <pubdate>1988</pubdate>
            <volume>102</volume>
            <issue>1-2</issue>
            <fpage>19</fpage>
            <lpage>27</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1007/BF01315559</pubid>
                  <pubid idtype="pmpid">3196167</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B22">
            <title>
               <p>Differential utilization of a conserved motif for the proteolytic maturation of vaccinia virus proteins.</p>
            </title>
            <aug>
               <au>
                  <snm>Whitehead</snm>
                  <fnm>SS</fnm>
               </au>
               <au>
                  <snm>Hruby</snm>
                  <fnm>DE</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1994</pubdate>
            <volume>200</volume>
            <issue>1</issue>
            <fpage>154</fpage>
            <lpage>161</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1006/viro.1994.1174</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B23">
            <title>
               <p>Vaccinia virus membrane proteins p8 and p16 are cotranslationally inserted into the rough endoplasmic reticulum and retained in the intermediate compartment.</p>
            </title>
            <aug>
               <au>
                  <snm>Salmons</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Kuhn</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Wylie</snm>
                  <fnm>F</fnm>
               </au>
               <au>
                  <snm>Schleich</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Rodriguez</snm>
                  <fnm>JR</fnm>
               </au>
               <au>
                  <snm>Rodriguez</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Esteban</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Griffiths</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Locker</snm>
                  <fnm>JK</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1997</pubdate>
            <volume>71</volume>
            <issue>10</issue>
            <fpage>7404</fpage>
            <lpage>7420</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">192086</pubid>
                  <pubid idtype="pmpid" link="fulltext">9311819</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B24">
            <title>
               <p>A complex of seven vaccinia virus proteins conserved in all chordopoxviruses is required for the association of membranes and viroplasm to form immature virions.</p>
            </title>
            <aug>
               <au>
                  <snm>Szajner</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Jaffe</snm>
                  <fnm>H</fnm>
               </au>
               <au>
                  <snm>Weisberg</snm>
                  <fnm>AS</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>2004</pubdate>
            <volume>330</volume>
            <issue>2</issue>
            <fpage>447</fpage>
            <lpage>459</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/j.virol.2004.10.008</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B25">
            <title>
               <p>Identification and analysis of three myristylated vaccinia virus late proteins.</p>
            </title>
            <aug>
               <au>
                  <snm>Martin</snm>
                  <fnm>KH</fnm>
               </au>
               <au>
                  <snm>Grosenbach</snm>
                  <fnm>DW</fnm>
               </au>
               <au>
                  <snm>Franke</snm>
                  <fnm>CA</fnm>
               </au>
               <au>
                  <snm>Hruby</snm>
                  <fnm>DE</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1997</pubdate>
            <volume>71</volume>
            <issue>7</issue>
            <fpage>5218</fpage>
            <lpage>5226</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">191757</pubid>
                  <pubid idtype="pmpid" link="fulltext">9188589</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B26">
            <title>
               <p>Entry of Vaccinia virus and cell-cell fusion require a highly conserved cysteine-rich membrane protein encoded by the A16L gene.</p>
            </title>
            <aug>
               <au>
                  <snm>Ojeda</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Senkevich</snm>
                  <fnm>TG</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>2006</pubdate>
            <volume>80</volume>
            <issue>1</issue>
            <fpage>51</fpage>
            <lpage>61</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1128/JVI.80.1.51-61.2006</pubid>
                  <pubid idtype="pmpid" link="fulltext">16352530</pubid>
                  <pubid idtype="pmcid">1317547</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B27">
            <title>
               <p>The vaccinia virus 14-kilodalton fusion protein forms a stable complex with the processed protein encoded by the vaccinia virus A17L gene.</p>
            </title>
            <aug>
               <au>
                  <snm>Rodriguez</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Rodriguez</snm>
                  <fnm>JR</fnm>
               </au>
               <au>
                  <snm>Esteban</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1993</pubdate>
            <volume>67</volume>
            <issue>6</issue>
            <fpage>3435</fpage>
            <lpage>3440</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">237688</pubid>
                  <pubid idtype="pmpid">8497059</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B28">
            <title>
               <p>Vaccinia virus A17L gene product is essential for an early step in virion morphogenesis.</p>
            </title>
            <aug>
               <au>
                  <snm>Rodriguez</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Esteban</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Rodriguez</snm>
                  <fnm>JR</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1995</pubdate>
            <volume>69</volume>
            <issue>8</issue>
            <fpage>4640</fpage>
            <lpage>4648</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">189265</pubid>
                  <pubid idtype="pmpid" link="fulltext">7609028</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B29">
            <title>
               <p>The second-largest subunit of the poxvirus RNA polymerase is similar to the corresponding subunits of procaryotic and eucaryotic RNA polymerases.</p>
            </title>
            <aug>
               <au>
                  <snm>Patel</snm>
                  <fnm>DD</fnm>
               </au>
               <au>
                  <snm>Pickup</snm>
                  <fnm>DJ</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1989</pubdate>
            <volume>63</volume>
            <issue>3</issue>
            <fpage>1076</fpage>
            <lpage>1086</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">247801</pubid>
                  <pubid idtype="pmpid">2915377</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B30">
            <title>
               <p>Mapping and nucleotide sequence of the vaccinia virus gene that encodes a 14-kilodalton fusion protein.</p>
            </title>
            <aug>
               <au>
                  <snm>Rodriguez</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Esteban</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1987</pubdate>
            <volume>61</volume>
            <issue>11</issue>
            <fpage>3550</fpage>
            <lpage>3554</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">255954</pubid>
                  <pubid idtype="pmpid">2822962</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B31">
            <title>
               <p>Identification, sequence, and expression of the gene encoding a Mr 35,000 subunit of the vaccinia virus DNA-dependent RNA polymerase.</p>
            </title>
            <aug>
               <au>
                  <snm>Amegadzie</snm>
                  <fnm>BY</fnm>
               </au>
               <au>
                  <snm>Ahn</snm>
                  <fnm>BY</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>J Biol Chem</source>
            <pubdate>1991</pubdate>
            <volume>266</volume>
            <issue>21</issue>
            <fpage>13712</fpage>
            <lpage>13718</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">1856205</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B32">
            <title>
               <p>Vaccinia virus A30L protein is required for association of viral membranes with dense viroplasm to form immature virions.</p>
            </title>
            <aug>
               <au>
                  <snm>Szajner</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Weisberg</snm>
                  <fnm>AS</fnm>
               </au>
               <au>
                  <snm>Wolffe</snm>
                  <fnm>EJ</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>2001</pubdate>
            <volume>75</volume>
            <issue>13</issue>
            <fpage>5752</fpage>
            <lpage>5761</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">114291</pubid>
                  <pubid idtype="pmpid" link="fulltext">11390577</pubid>
                  <pubid idtype="doi">10.1128/JVI.75.13.5752-5761.2001</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B33">
            <title>
               <p>Extracellular vaccinia virus envelope glycoprotein encoded by the A33R gene.</p>
            </title>
            <aug>
               <au>
                  <snm>Roper</snm>
                  <fnm>RL</fnm>
               </au>
               <au>
                  <snm>Payne</snm>
                  <fnm>LG</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1996</pubdate>
            <volume>70</volume>
            <issue>6</issue>
            <fpage>3753</fpage>
            <lpage>3762</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">190251</pubid>
                  <pubid idtype="pmpid" link="fulltext">8648710</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B34">
            <title>
               <p>Identification and characterization of an extracellular envelope glycoprotein affecting vaccinia virus egress.</p>
            </title>
            <aug>
               <au>
                  <snm>Duncan</snm>
                  <fnm>SA</fnm>
               </au>
               <au>
                  <snm>Smith</snm>
                  <fnm>GL</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1996</pubdate>
            <volume>66</volume>
            <issue>3</issue>
            <fpage>1610</fpage>
            <lpage>1621</lpage>
         </bibl>
         <bibl id="B35">
            <title>
               <p>Sequence analysis, expression, and deletion of a vaccinia virus gene encoding a homolog of profilin, a eukaryotic actin-binding protein.</p>
            </title>
            <aug>
               <au>
                  <snm>Blasco</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Cole</snm>
                  <fnm>NB</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1991</pubdate>
            <volume>65</volume>
            <issue>9</issue>
            <fpage>4598</fpage>
            <lpage>4608</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">248914</pubid>
                  <pubid idtype="pmpid">1870190</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B36">
            <title>
               <p>A46R and A52R from vaccinia virus are antagonists of host IL-1 and toll-like receptor signaling.</p>
            </title>
            <aug>
               <au>
                  <snm>Bowie</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Kiss-Toth</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Symons</snm>
                  <fnm>JA</fnm>
               </au>
               <au>
                  <snm>Smith</snm>
                  <fnm>GL</fnm>
               </au>
               <au>
                  <snm>Dower</snm>
                  <fnm>SK</fnm>
               </au>
               <au>
                  <snm>O'Neill</snm>
                  <fnm>LA</fnm>
               </au>
            </aug>
            <source>Proc Natl Aca Sci</source>
            <pubdate>2000</pubdate>
            <volume>97</volume>
            <issue>18</issue>
            <fpage>10162</fpage>
            <lpage>10167</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1073/pnas.160027697</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B37">
            <title>
               <p>Nucleotide sequence of the vaccinia virus hemagglutinin gene.</p>
            </title>
            <aug>
               <au>
                  <snm>Shida</snm>
                  <fnm>H</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1986</pubdate>
            <volume>150</volume>
            <issue>2</issue>
            <fpage>451</fpage>
            <lpage>462</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/0042-6822(86)90309-0</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B38">
            <title>
               <p>A constitutively expressed vaccinia gene encodes a 42-kDa glycoprotein related to complement control factors that forms part of the extracellular virus envelope.</p>
            </title>
            <aug>
               <au>
                  <snm>Engelstad</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Howard</snm>
                  <fnm>ST</fnm>
               </au>
               <au>
                  <snm>Smith</snm>
                  <fnm>GL</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1992</pubdate>
            <volume>188</volume>
            <issue>2</issue>
            <fpage>801</fpage>
            <lpage>810</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/0042-6822(92)90535-W</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B39">
            <title>
               <p>Vaccinia virus serpins B13R (SPI-2) and B22R (SPI-1) encode M(r) 38.5 and 40K, intracellular polypeptides that do not affect virus virulence in a murine intranasal model.</p>
            </title>
            <aug>
               <au>
                  <snm>Kettle</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Blake</snm>
                  <fnm>NW</fnm>
               </au>
               <au>
                  <snm>Law</snm>
                  <fnm>KM</fnm>
               </au>
               <au>
                  <snm>Smith</snm>
                  <fnm>GL</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1995</pubdate>
            <volume>206</volume>
            <issue>1</issue>
            <fpage>136</fpage>
            <lpage>147</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/S0042-6822(95)80028-X</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B40">
            <title>
               <p>Identification of the DNA sequences encoding the large subunit of the mRNA-capping enzyme of vaccinia virus.</p>
            </title>
            <aug>
               <au>
                  <snm>Morgan</snm>
                  <fnm>JR</fnm>
               </au>
               <au>
                  <snm>Cohen</snm>
                  <fnm>LK</fnm>
               </au>
               <au>
                  <snm>Roberts</snm>
                  <fnm>BE</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1984</pubdate>
            <volume>52</volume>
            <issue>1</issue>
            <fpage>206</fpage>
            <lpage>214</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">254507</pubid>
                  <pubid idtype="pmpid">6090698</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B41">
            <title>
               <p>Genetic and biochemical characterization of vaccinia virus genes D2L and D3R which encode virion structural proteins.</p>
            </title>
            <aug>
               <au>
                  <snm>Dyster</snm>
                  <fnm>LM</fnm>
               </au>
               <au>
                  <snm>Niles</snm>
                  <fnm>EG</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1991</pubdate>
            <volume>182</volume>
            <issue>2</issue>
            <fpage>455</fpage>
            <lpage>467</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/0042-6822(91)90586-Z</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B42">
            <title>
               <p>Vaccinia virus gene encoding a component of the viral early transcription factor.</p>
            </title>
            <aug>
               <au>
                  <snm>Broyles</snm>
                  <fnm>SS</fnm>
               </au>
               <au>
                  <snm>Fesler</snm>
                  <fnm>BS</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1990</pubdate>
            <volume>64</volume>
            <issue>4</issue>
            <fpage>1523</fpage>
            <lpage>1529</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">249286</pubid>
                  <pubid idtype="pmpid">2138681</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B43">
            <title>
               <p>Vaccinia virus gene D8 encodes a virion transmembrane protein.</p>
            </title>
            <aug>
               <au>
                  <snm>Niles</snm>
                  <fnm>EG</fnm>
               </au>
               <au>
                  <snm>Seto</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1988</pubdate>
            <volume>62</volume>
            <issue>10</issue>
            <fpage>3772</fpage>
            <lpage>3778</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">253521</pubid>
                  <pubid idtype="pmpid">3418784</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B44">
            <title>
               <p>[Insertion mutants of the vaccinia virus. The effect of inactivating E7R and D8L genes on the biological properties of the virus].</p>
            </title>
            <aug>
               <au>
                  <snm>Chernos</snm>
                  <fnm>VI</fnm>
               </au>
               <au>
                  <snm>Vovk</snm>
                  <fnm>TS</fnm>
               </au>
               <au>
                  <snm>Ivanova</snm>
                  <fnm>ON</fnm>
               </au>
               <au>
                  <snm>Antonova</snm>
                  <fnm>TP</fnm>
               </au>
               <au>
                  <snm>Loparev</snm>
                  <fnm>VN</fnm>
               </au>
            </aug>
            <source>Mol Gen Mikrobiol Virusol</source>
            <pubdate>1993</pubdate>
            <volume>Mar-Apr</volume>
            <issue>2</issue>
            <fpage>30</fpage>
            <lpage>34</lpage>
         </bibl>
         <bibl id="B45">
            <title>
               <p>Identification of the vaccinia virus gene encoding nucleoside triphosphate phosphohydrolase I, a DNA-dependent ATPase.</p>
            </title>
            <aug>
               <au>
                  <snm>Broyles</snm>
                  <fnm>SS</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1987</pubdate>
            <volume>61</volume>
            <issue>5</issue>
            <fpage>1738</fpage>
            <lpage>1742</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">254168</pubid>
                  <pubid idtype="pmpid">2437324</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B46">
            <title>
               <p>Vaccinia virus gene D12L encodes the small subunit of the viral mRNA capping enzyme.</p>
            </title>
            <aug>
               <au>
                  <snm>Niles</snm>
                  <fnm>EG</fnm>
               </au>
               <au>
                  <snm>Lee-Chen</snm>
                  <fnm>GJ</fnm>
               </au>
               <au>
                  <snm>Shuman</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
               <au>
                  <snm>Broyles</snm>
                  <fnm>SS</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1989</pubdate>
            <volume>172</volume>
            <issue>2</issue>
            <fpage>513</fpage>
            <lpage>522</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/0042-6822(89)90194-3</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B47">
            <title>
               <p>Poly(A) polymerase from vaccinia virus-infected cells. I. Partial purification and characterization.</p>
            </title>
            <aug>
               <au>
                  <snm>Brakel</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Kates</snm>
                  <fnm>JR</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1974</pubdate>
            <volume>14</volume>
            <issue>4</issue>
            <fpage>715</fpage>
            <lpage>723</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">355574</pubid>
                  <pubid idtype="pmpid">4417406</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B48">
            <title>
               <p>Poly(A) polymerase and a dissociable polyadenylation stimulatory factor encoded by vaccinia virus.</p>
            </title>
            <aug>
               <au>
                  <snm>Gershon</snm>
                  <fnm>PD</fnm>
               </au>
               <au>
                  <snm>Ahn</snm>
                  <fnm>BY</fnm>
               </au>
               <au>
                  <snm>Garfield</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Cell</source>
            <pubdate>1991</pubdate>
            <volume>66</volume>
            <issue>6</issue>
            <fpage>1269</fpage>
            <lpage>1278</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/0092-8674(91)90048-4</pubid>
                  <pubid idtype="pmpid" link="fulltext">1670500</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B49">
            <title>
               <p>The E3L gene of vaccinia virus encodes an inhibitor of the interferon-induced double-stranded RNA-dependent protein kinase.</p>
            </title>
            <aug>
               <au>
                  <snm>Chang</snm>
                  <fnm>HW</fnm>
               </au>
               <au>
                  <snm>Watson</snm>
                  <fnm>JC</fnm>
               </au>
               <au>
                  <snm>Jacobs</snm>
                  <fnm>BT</fnm>
               </au>
            </aug>
            <source>Proc Natl Aca Sci</source>
            <pubdate>1992</pubdate>
            <volume>89</volume>
            <fpage>4825</fpage>
            <lpage>4829</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1073/pnas.89.11.4825</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B50">
            <title>
               <p>Identification of rpo30, a vaccinia virus RNA polymerase gene with structural similarity to a eucaryotic transcription elongation factor.</p>
            </title>
            <aug>
               <au>
                  <snm>Ahn</snm>
                  <fnm>BY</fnm>
               </au>
               <au>
                  <snm>Gershon</snm>
                  <fnm>PD</fnm>
               </au>
               <au>
                  <snm>Jones</snm>
                  <fnm>EV</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Mol Cell Biol</source>
            <pubdate>1990</pubdate>
            <volume>10</volume>
            <issue>10</issue>
            <fpage>5433</fpage>
            <lpage>5441</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">361248</pubid>
                  <pubid idtype="pmpid">2398897</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B51">
            <title>
               <p>Vaccinia virus DNA replication occurs in endoplasmic reticulum-enclosed cytoplasmic mini-nuclei.</p>
            </title>
            <aug>
               <au>
                  <snm>Tolonen</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Doglio</snm>
                  <fnm>L</fnm>
               </au>
               <au>
                  <snm>Schleich</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Krijnse Locker</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>Mol Bio Cell</source>
            <pubdate>2001</pubdate>
            <volume>12</volume>
            <issue>7</issue>
            <fpage>2031</fpage>
            <lpage>2046</lpage>
         </bibl>
         <bibl id="B52">
            <title>
               <p>The Vaccinia virus E8R gene product: a viral membrane protein that is made early in infection and packaged into the virions' core.</p>
            </title>
            <aug>
               <au>
                  <snm>Doglio</snm>
                  <fnm>L</fnm>
               </au>
               <au>
                  <snm>De Marco</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Schleich</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Roos</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Krijnse Locker</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>2002</pubdate>
            <volume>76</volume>
            <issue>19</issue>
            <fpage>9773</fpage>
            <lpage>9786</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">136492</pubid>
                  <pubid idtype="pmpid" link="fulltext">12208956</pubid>
                  <pubid idtype="doi">10.1128/JVI.76.19.9773-9786.2002</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B53">
            <title>
               <p>A viral member of the ERV1/ALR protein family participates in a cytoplasmic pathway of disulfide bond formation.</p>
            </title>
            <aug>
               <au>
                  <snm>Senkevich</snm>
                  <fnm>TG</fnm>
               </au>
               <au>
                  <snm>White</snm>
                  <fnm>CL</fnm>
               </au>
               <au>
                  <snm>Koonin</snm>
                  <fnm>EV</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Proc Natl Aca Sci</source>
            <pubdate>2000</pubdate>
            <volume>97</volume>
            <issue>22</issue>
            <fpage>12068</fpage>
            <lpage>12073</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1073/pnas.210397997</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B54">
            <title>
               <p>A temperature-sensitive mutation of the vaccinia virus E11 gene encoding a 15-kDa virion component.</p>
            </title>
            <aug>
               <au>
                  <snm>Wang</snm>
                  <fnm>SP</fnm>
               </au>
               <au>
                  <snm>Shuman</snm>
                  <fnm>S</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1996</pubdate>
            <volume>216</volume>
            <issue>1</issue>
            <fpage>252</fpage>
            <lpage>257</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1006/viro.1996.0057</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B55">
            <title>
               <p>Characterization of the vaccinia virus F8L protein.</p>
            </title>
            <aug>
               <au>
                  <snm>Higley</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Way</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>J Gen Virol</source>
            <pubdate>1997</pubdate>
            <volume>78</volume>
            <issue>10</issue>
            <fpage>2633</fpage>
            <lpage>2637</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">9349485</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B56">
            <title>
               <p>Characterization of a protein kinase and two phosphate acceptor proteins from vaccinia virions.</p>
            </title>
            <aug>
               <au>
                  <snm>Kleiman</snm>
                  <fnm>JH</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>J Biol Chem</source>
            <pubdate>1975</pubdate>
            <volume>250</volume>
            <issue>7</issue>
            <fpage>2430</fpage>
            <lpage>2437</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">235513</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B57">
            <title>
               <p>Vaccinia protein kinase 2: a second essential serine/threonine protein kinase encoded by vaccinia virus.</p>
            </title>
            <aug>
               <au>
                  <snm>Lin</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Broyles</snm>
                  <fnm>SS</fnm>
               </au>
            </aug>
            <source>Proc Natl Aca Sci</source>
            <pubdate>1994</pubdate>
            <volume>91</volume>
            <issue>16</issue>
            <fpage>7653</fpage>
            <lpage>7657</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1073/pnas.91.16.7653</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B58">
            <title>
               <p>Extracellular vaccinia virus formation and cell-to-cell virus transmission are prevented by deletion of the gene encoding the 37,000-Dalton outer envelope protein.</p>
            </title>
            <aug>
               <au>
                  <snm>Blasco</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1991</pubdate>
            <volume>65</volume>
            <issue>11</issue>
            <fpage>5910</fpage>
            <lpage>5920</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">250254</pubid>
                  <pubid idtype="pmpid">1920620</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B59">
            <title>
               <p>Purification and characterization of a superhelix binding protein from vaccinia virus.</p>
            </title>
            <aug>
               <au>
                  <snm>Kao</snm>
                  <fnm>SY</fnm>
               </au>
               <au>
                  <snm>Ressner</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Kates</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Bauer</snm>
                  <fnm>WR</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1981</pubdate>
            <volume>111</volume>
            <issue>2</issue>
            <fpage>500</fpage>
            <lpage>508</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/0042-6822(81)90352-4</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B60">
            <title>
               <p>A transcriptionally controlled trans-processing assay: putative identification of a vaccinia virus-encoded proteinase which cleaves precursor protein P25K.</p>
            </title>
            <aug>
               <au>
                  <snm>Whitehead</snm>
                  <fnm>SS</fnm>
               </au>
               <au>
                  <snm>Hruby</snm>
                  <fnm>DE</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1994</pubdate>
            <volume>68</volume>
            <issue>11</issue>
            <fpage>7603</fpage>
            <lpage>7608</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">237210</pubid>
                  <pubid idtype="pmpid">7933150</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B61">
            <title>
               <p>Poxvirus multiprotein entry-fusion complex</p>
            </title>
            <aug>
               <au>
                  <snm>Senkevich</snm>
                  <fnm>TG</fnm>
               </au>
               <au>
                  <snm>Ojeda</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Townsley</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Nelson</snm>
                  <fnm>GE</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Proc Natl Aca Sci</source>
            <pubdate>2005</pubdate>
            <volume>102</volume>
            <issue>51</issue>
            <fpage>18572</fpage>
            <lpage>18577</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1073/pnas.0509239102</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B62">
            <title>
               <p>Vaccinia virus G4L gene encodes a second glutaredoxin.</p>
            </title>
            <aug>
               <au>
                  <snm>Gvakharia</snm>
                  <fnm>BO</fnm>
               </au>
               <au>
                  <snm>Koonin</snm>
                  <fnm>EK</fnm>
               </au>
               <au>
                  <snm>Mathews</snm>
                  <fnm>CK</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1996</pubdate>
            <volume>226</volume>
            <issue>2</issue>
            <fpage>408</fpage>
            <lpage>411</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1006/viro.1996.0669</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B63">
            <title>
               <p>Vaccinia virus G7L protein Interacts with the A30L protein and is required for association of viral membranes with dense viroplasm to form immature virions.</p>
            </title>
            <aug>
               <au>
                  <snm>Szajner</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Jaffe</snm>
                  <fnm>H</fnm>
               </au>
               <au>
                  <snm>Weisberg</snm>
                  <fnm>AS</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>2003</pubdate>
            <volume>77</volume>
            <issue>6</issue>
            <fpage>3418</fpage>
            <lpage>3429</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">149536</pubid>
                  <pubid idtype="pmpid" link="fulltext">12610117</pubid>
                  <pubid idtype="doi">10.1128/JVI.77.6.3418-3429.2003</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B64">
            <title>
               <p>A Tyr/Ser protein phosphatase encoded by vaccinia virus.</p>
            </title>
            <aug>
               <au>
                  <snm>Guan</snm>
                  <fnm>KL</fnm>
               </au>
               <au>
                  <snm>Broyles</snm>
                  <fnm>SS</fnm>
               </au>
               <au>
                  <snm>Dixon</snm>
                  <fnm>JE</fnm>
               </au>
            </aug>
            <source>Nature</source>
            <pubdate>1991</pubdate>
            <volume>350</volume>
            <issue>6316</issue>
            <fpage>359</fpage>
            <lpage>362</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1038/350359a0</pubid>
                  <pubid idtype="pmpid" link="fulltext">1848923</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B65">
            <title>
               <p>[Identification of the gene for the immunodominant p35 protein from vaccinia virus].</p>
            </title>
            <aug>
               <au>
                  <snm>Zinov'ev</snm>
                  <fnm>VV</fnm>
               </au>
               <au>
                  <snm>Ovechkina</snm>
                  <fnm>LG</fnm>
               </au>
               <au>
                  <snm>Matskova</snm>
                  <fnm>LV</fnm>
               </au>
               <au>
                  <snm>Balakhnin</snm>
                  <fnm>SM</fnm>
               </au>
               <au>
                  <snm>Malygin</snm>
                  <fnm>EG</fnm>
               </au>
               <au>
                  <snm>Chertov</snm>
                  <fnm>OI</fnm>
               </au>
               <au>
                  <snm>Telezhinskaia</snm>
                  <fnm>IN</fnm>
               </au>
               <au>
                  <snm>Zaitseva</snm>
                  <fnm>EV</fnm>
               </au>
               <au>
                  <snm>Golubeva</snm>
                  <fnm>TB</fnm>
               </au>
            </aug>
            <source>Mol Biol (Mosk)</source>
            <pubdate>1992</pubdate>
            <volume>26</volume>
            <issue>1</issue>
            <fpage>142</fpage>
            <lpage>149</lpage>
            <xrefbib>
               <pubid idtype="pmpid">1508163</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B66">
            <title>
               <p>RNA polymerase-associated transcription specificity factor encoded by vaccinia virus.</p>
            </title>
            <aug>
               <au>
                  <snm>Ahn</snm>
                  <fnm>BY</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Proc Natl Aca Sci</source>
            <pubdate>1992</pubdate>
            <volume>89</volume>
            <issue>8</issue>
            <fpage>3536</fpage>
            <lpage>3540</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1073/pnas.89.8.3536</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B67">
            <title>
               <p>Molecular characterization of a prominent antigen of the vaccinia virus envelope.</p>
            </title>
            <aug>
               <au>
                  <snm>Gordon</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Kovala</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Dales</snm>
                  <fnm>S</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1988</pubdate>
            <volume>167</volume>
            <issue>2</issue>
            <fpage>361</fpage>
            <lpage>369</lpage>
         </bibl>
         <bibl id="B68">
            <title>
               <p>The vaccinia virus I1 protein is essential for the assembly of mature virions.</p>
            </title>
            <aug>
               <au>
                  <snm>Klemperer</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Ward</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Evans</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Traktman</snm>
                  <fnm>P</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1997</pubdate>
            <volume>71</volume>
            <issue>12</issue>
            <fpage>9285</fpage>
            <lpage>9294</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">230231</pubid>
                  <pubid idtype="pmpid" link="fulltext">9371587</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B69">
            <title>
               <p>Vaccinia virus intracellular DNA-protein complex: biochemical characteristics of associated protein.</p>
            </title>
            <aug>
               <au>
                  <snm>Polisky</snm>
                  <fnm>B</fnm>
               </au>
               <au>
                  <snm>Kates</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1972</pubdate>
            <volume>49</volume>
            <issue>1</issue>
            <fpage>168</fpage>
            <lpage>179</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/S0042-6822(72)80018-7</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B70">
            <title>
               <p>Characterization of the single-stranded DNA binding protein encoded by the vaccinia virus I3 gene.</p>
            </title>
            <aug>
               <au>
                  <snm>Rochester</snm>
                  <fnm>SC</fnm>
               </au>
               <au>
                  <snm>Traktman</snm>
                  <fnm>P</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1998</pubdate>
            <volume>72</volume>
            <issue>4</issue>
            <fpage>2917</fpage>
            <lpage>2926</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">109737</pubid>
                  <pubid idtype="pmpid" link="fulltext">9525612</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B71">
            <title>
               <p>[A structure-activity study of the HindIII-I fragment of the L-IVP strain of vaccinia virus genome. I. Cloning of I5 gene and identification of its protein product]</p>
            </title>
            <aug>
               <au>
                  <snm>Netesova</snm>
                  <fnm>NA</fnm>
               </au>
               <au>
                  <snm>Muravlev</snm>
                  <fnm>AI</fnm>
               </au>
               <au>
                  <snm>Chikaev</snm>
                  <fnm>NA</fnm>
               </au>
               <au>
                  <snm>Malygin</snm>
                  <fnm>EG</fnm>
               </au>
            </aug>
            <source>Mol Biol (Mosk)</source>
            <pubdate>1995</pubdate>
            <volume>25</volume>
            <issue>6</issue>
            <fpage>1526</fpage>
            <lpage>1532</lpage>
         </bibl>
         <bibl id="B72">
            <title>
               <p>The vaccinia virus I7L gene product is the core protein proteinase.</p>
            </title>
            <aug>
               <au>
                  <snm>Byrd</snm>
                  <fnm>CM</fnm>
               </au>
               <au>
                  <snm>Bolken</snm>
                  <fnm>TC</fnm>
               </au>
               <au>
                  <snm>Hruby</snm>
                  <fnm>DE</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>2002</pubdate>
            <volume>76</volume>
            <issue>17</issue>
            <fpage>8973</fpage>
            <lpage>8976</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">136993</pubid>
                  <pubid idtype="pmpid" link="fulltext">12163618</pubid>
                  <pubid idtype="doi">10.1128/JVI.76.17.8973-8976.2002</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B73">
            <title>
               <p>Vaccinia virus encodes four putative DNA and/or RNA helicases distantly related to each other.</p>
            </title>
            <aug>
               <au>
                  <snm>Koonin</snm>
                  <fnm>EV</fnm>
               </au>
               <au>
                  <snm>Senkevich</snm>
                  <fnm>TG</fnm>
               </au>
            </aug>
            <source>J Gen Virol</source>
            <pubdate>1992</pubdate>
            <volume>73</volume>
            <issue>4</issue>
            <fpage>989</fpage>
            <lpage>993</lpage>
            <xrefbib>
               <pubid idtype="pmpid">1321883</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B74">
            <title>
               <p>Vaccinia virus J1R protein: a viral membrane protein that is essential for virion morphogenesis</p>
            </title>
            <aug>
               <au>
                  <snm>Ciu</snm>
                  <fnm>WL</fnm>
               </au>
               <au>
                  <snm>Chang</snm>
                  <fnm>W</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>2002</pubdate>
            <volume>76</volume>
            <issue>19</issue>
            <fpage>9575</fpage>
            <lpage>9587</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">136503</pubid>
                  <pubid idtype="pmpid" link="fulltext">12208937</pubid>
                  <pubid idtype="doi">10.1128/JVI.76.19.9575-9587.2002</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B75">
            <title>
               <p>Cap-specific mRNA (nucleoside-O2-)-methyltransferase and poly(A) polymerase stimulatory activities of vaccinia virus are mediated by a single protein.</p>
            </title>
            <aug>
               <au>
                  <snm>Schnierle</snm>
                  <fnm>BS</fnm>
               </au>
               <au>
                  <snm>Gershon</snm>
                  <fnm>PD</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Proc Natl Aca Sci</source>
            <pubdate>1992</pubdate>
            <volume>181</volume>
            <issue>7</issue>
            <fpage>727</fpage>
            <lpage>732</lpage>
         </bibl>
         <bibl id="B76">
            <title>
               <p>Homology between RNA polymerases of poxviruses, prokaryotes, and eukaryotes: nucleotide sequence and transcriptional analysis of vaccinia virus genes encoding 147-kDa and 22-kDa subunits.</p>
            </title>
            <aug>
               <au>
                  <snm>Broyles</snm>
                  <fnm>SS</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Proc Natl Aca Sci</source>
            <pubdate>1986</pubdate>
            <volume>83</volume>
            <issue>10</issue>
            <fpage>3141</fpage>
            <lpage>3145</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1073/pnas.83.10.3141</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B77">
            <title>
               <p>A human homolog of the vaccinia virus HindIII K4L gene is a member of the phospholipase D superfamily.</p>
            </title>
            <aug>
               <au>
                  <snm>Cao</snm>
                  <fnm>JX</fnm>
               </au>
               <au>
                  <snm>Koop</snm>
                  <fnm>BF</fnm>
               </au>
               <au>
                  <snm>Upton</snm>
                  <fnm>C</fnm>
               </au>
            </aug>
            <source>Vir Res</source>
            <pubdate>1997</pubdate>
            <volume>48</volume>
            <issue>1</issue>
            <fpage>11</fpage>
            <lpage>18</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/S0168-1702(96)01422-0</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B78">
            <title>
               <p>Use of a cell-free system to identify the vaccinia virus L1R gene product as the major late myristylated virion protein M25.</p>
            </title>
            <aug>
               <au>
                  <snm>Franke</snm>
                  <fnm>CA</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>EM</fnm>
               </au>
               <au>
                  <snm>Hruby</snm>
                  <fnm>DE</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1990</pubdate>
            <volume>64</volume>
            <issue>12</issue>
            <fpage>5988</fpage>
            <lpage>5996</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">248772</pubid>
                  <pubid idtype="pmpid">2243383</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B79">
            <title>
               <p>Purification and characterization of vaccinia virus structural protein VP8.</p>
            </title>
            <aug>
               <au>
                  <snm>WP</snm>
                  <fnm>Y</fnm>
               </au>
               <au>
                  <snm>WR</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1988</pubdate>
            <volume>167</volume>
            <issue>2</issue>
            <fpage>578</fpage>
            <lpage>584</lpage>
         </bibl>
         <bibl id="B80">
            <title>
               <p>Vaccinia virus encodes a protein with similarity to glutaredoxins.</p>
            </title>
            <aug>
               <au>
                  <snm>Johnson</snm>
                  <fnm>GP</fnm>
               </au>
               <au>
                  <snm>Goebel</snm>
                  <fnm>SJ</fnm>
               </au>
               <au>
                  <snm>Perkus</snm>
                  <fnm>ME</fnm>
               </au>
               <au>
                  <snm>Davis</snm>
                  <fnm>SW</fnm>
               </au>
               <au>
                  <snm>Winslow</snm>
                  <fnm>JP</fnm>
               </au>
               <au>
                  <snm>Paoletti</snm>
                  <fnm>E</fnm>
               </au>
            </aug>
            <source>Virol</source>
            <pubdate>1991</pubdate>
            <volume>181</volume>
            <issue>1</issue>
            <fpage>378</fpage>
            <lpage>381</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/0042-6822(91)90508-9</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B81">
            <title>
               <p>Glutaredoxin homolog encoded by vaccinia virus is a virion-associated enzyme with thioltransferase and dehydroascorbate reductase activities.</p>
            </title>
            <aug>
               <au>
                  <snm>Ahn</snm>
                  <fnm>BY</fnm>
               </au>
               <au>
                  <snm>Moss</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Proc Natl Aca Sci</source>
            <pubdate>1992</pubdate>
            <volume>89</volume>
            <issue>15</issue>
            <fpage>7060</fpage>
            <lpage>7064</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1073/pnas.89.15.7060</pubid>
            </xrefbib>
         </bibl>
      </refgrp>
   </bm>
</art>
