Table 1

Synthetic peptides used in this study

Peptide

FMDV protein (residues)

Sequence


B

VP1 [136-154]

YTASARGDLAHLTTTHARH- amide

T

3A [21-35]

AAIEFFEGMVHDSIK- amide

TB

3A [21-35]

VP1 [136-154]

AAIEFFEGMVHDSIKYTASARGDLAHLTTTHARH- amide


Cubillos et al. Virology Journal 2012 9:66   doi:10.1186/1743-422X-9-66

Open Data