Table 2

Conservation of T cell epitopes identified in the PB1 of influenza A and B viruses
Peptide locationa Peptide sequence of influenza A PB1b Corresponding peptide in influenza B PB1c Amino acid identityd Restricting allele Reference
1-15 MDVNPTLLFLKVPAQ *NI**YF**ID**(I/V)* 8/15 DR supertype [54]
7-14 LLFLKVPA F**ID**(I/V) 4/8 A2 supertype [54]
30-38 YSHGTGTGY ********* 9/9 A1 supertype [55]
41-49 DTVNRTHQY ***I***** 8/9 A26 [60]
92-106 MAFLEESHPGIFENS LDRMD*E***L*QAA 5/15 DR supertype [54]
166-174 FLKDVMESM *CQ*IID*L 3/9 A2 [60]
238-246 RRAIATPGM ******A*I 7/9 B27 [61]
254-262 FVEALARSI V**N**KN* 5/9 A2 supertype [54]
257-265 TLARSICEK N**KN***N 5/9 A3 supertype [54]
263-271 CEKLEQSGL **N****** 8/9 B44 [54]
316-330 RMFLAMITYITRNQP *I****TER***DS* 9/15 DR supertype [54]
347-355 KMARLGKGY *I******F 7/9 B62 [60]
349-357 ARLGKGYMF ******F*I 7/9 B27 [60]
357-364 FESKSMKL IT**TKR* 3/8 B44 [54]
404-418 SPGMMMGMFNMLSTV *************** 15/15 DR supertype [54]
407-415 MMMGMFNML ********* 9/9 A2 supertype [54]
408-422 MMGMFNMLSTVLGVS **************A 14/15 DR supertype [54]
412-421 FNMLSTVLGV ********** 10/10 A2 supertype [54]
413-421 NMLSTVLGV ********** 9/9 A*0201 [39]
471-480 KLVGINMSKK **L*(*/V)***** 8~9/10 A3 supertype [55]
488-497 GTFEFTSFFY *M*****M** 8/10 A3 supertype [55]
489-497 TFEFTSFFY M*****M** 7/9 A1 supertype [54]
490-497 FEFTSFFY *****M** 7/8 B44 [54]
496-505 FYRYGFVANF ***D***S** 8/10 A24 supertype [55]
501-509 FVANFSMEL **S**A**(*/I) 6~7/9 A2 supertype [54]
505-514 FSMELPSFGV *A**(*/I)***** 8~9/10 A2 supertype [54]
509-517 LPSFGVSGI (*/I)*****A*V 6~7/9 B7 [54]
540-548 GPATAQMAL ******T*I 7/9 B7 [60]
566-574 TQIQTRRSF SKVEGK*MK 1/9 B62 [60]
590-599 LVSDGGPNLY **A*****I* 8/10 A1 supertype [55]
591-599 VSDGGPNLY *A*****I* 7/9 A1 [62]
741-749 AEIMKICST EKA*AHLGE 1/9 B44 [54]
21-38 TFPYTGDPPYSHGTGTGY ******V*********** 17/18 CD8 [63]
43-60 VNRTHQYSEKGKWTTNTE *I***E**N***QY(I/V)SD(V/I) 9/18 ? [63]
57-73 TNTETGAPQLNPIDGPL (I/V)SD(V/I)**CTM(V/I)D*TN*** 6/17 ? [63]
64-82 PQLNPIDGPLPEDNEPSGY (T/A/V)MVD*TN**********A* 12/19 ? [63]
86-103 DCVLEAMAFLEESHPGIF ******LDRMD*E***L* 11/18 ? [63]
123-140 TQGRQTYDWTLNRNQPAA ******F***VC****** 15/18 ? [63]
270-287 GLPVGGNEKKAKLANVVR *************S*A*A 15/18 ? [63]
316-333 RMFLAMITYITRNQPEWF *I****TER***DS*I** 11/18 ? [63]
395-428 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ FNEE***********************AA*GIKN 24/34 ? [64]
402-419 SLSPGMMMGMFNMLSTVL ****************** 18/18 CD4 [63]
410-426 GMFNMLSTVLGVSILNL ************AA*GI 13/17 ? [63]
417-433 TVLGVSILNLGQKRYTK *****AA*GIKNIGNKE 6/17 CD4 [63]
432-449 TKTTYWWDGLQSSDDFAL GNKE*L************ 13/18 CD4 [63]
447-463 FALIVNAPNYAGIQAGV ***F***KDE*TCME*I 8/17 ? [65]
470-486 CKLVGINMSKKKSYINR ***L*(*/V)********C*E 13~14/17 ? [63]
498-514 RYGFVANFSMELPSFGV *D***S**A**(*/I)***** 13~14/17 CD8 [63]
505-521 FSMELPSFGVSGINESA *A**(*/I)*****A*V**** 13~14/17 ? [63]
548–564 LQLFIKDYRYTYRCHRG I****A******K**** 14/17 ? [65]
562-579 HRGDTQIQTRRSFELKKL ****SKVEGK*MKII*E* 7/18 ? [63]
705-722 YRRPVGISSMVEAMVSRA **K***QH**L***AH*L 11/18 CD8 [63]

aBased on the PB1 of A/Puerto Rico/8/34(H1N1) (NP_040985).

bAmino acid sequence in the original publication.

cB/Wisconsin/01/2010 (B/Yamagata/16/88-lineage) and B/Brisbane/60/2008 (B/Victoria/2/87-like lineage).

dEmbolden when all amino acids are identical or when the observed amino acid variation in B viruses does not decrease the SYFPEITHI binding score (http://www.syfpeithi.de/bin/MHCServer.dll/EpitopePrediction.htm webcite).

Terajima et al.

Terajima et al. Virology Journal 2013 10:244   doi:10.1186/1743-422X-10-244

Open Data